BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0685 (435 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 30 0.008 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 21 6.7 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 30.3 bits (65), Expect = 0.008 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -3 Query: 433 FFSFLNLTPYNY*YWMNTSNIKTAQIL 353 FFSF + + Y YW TSN+ T+++L Sbjct: 12 FFSFCCILFFIYLYWQQTSNLTTSKLL 38 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 20.6 bits (41), Expect = 6.7 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = -3 Query: 223 IFTLSRLDVYILLSYHTVTI*ESYWIDLTKRAIRSLLRTETGG 95 +FT+ ++ +L+Y++ T + +D R + SL GG Sbjct: 298 LFTIDNKLLFGVLAYYSTTCDIATILDFWVRCVLSLHCAAVGG 340 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,003 Number of Sequences: 336 Number of extensions: 1698 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9670396 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -