BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0675 (662 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 23 2.2 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 2.2 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 23 2.2 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 22 3.9 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 22 3.9 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 23.0 bits (47), Expect = 2.2 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +1 Query: 13 DHPDHRPPLPLRQDQDTGGPENS 81 D P PP P +D D+ P+N+ Sbjct: 208 DVPSTIPPPPPEEDDDSNIPQNN 230 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 23.0 bits (47), Expect = 2.2 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +1 Query: 10 EDHPDHRPPLPLRQDQDTGGPENSN 84 E HP H P +Q GG + +N Sbjct: 173 EQHPQHHQPHHQQQHMMYGGQQGAN 197 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 23.0 bits (47), Expect = 2.2 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +1 Query: 10 EDHPDHRPPLPLRQDQDTGGPENSN 84 E HP H P +Q GG + +N Sbjct: 175 EQHPQHHQPHHQQQHMMYGGQQGAN 199 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 22.2 bits (45), Expect = 3.9 Identities = 11/33 (33%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +2 Query: 8 RKTILTTAHHFPYVKTRIQVV-QKTQIILSPIE 103 R+ ILT A HF ++ IQ+ ++T+ ++ +E Sbjct: 126 RRKILTPAFHFNILQEFIQIFNEETKRLVEDLE 158 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 22.2 bits (45), Expect = 3.9 Identities = 11/33 (33%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +2 Query: 8 RKTILTTAHHFPYVKTRIQVV-QKTQIILSPIE 103 R+ ILT A HF ++ IQ+ ++T+ ++ +E Sbjct: 126 RRKILTPAFHFNILQEFIQIFNEETKRLVEDLE 158 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,121 Number of Sequences: 336 Number of extensions: 1919 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -