BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0675 (662 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 24 1.1 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 7.9 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 24.2 bits (50), Expect = 1.1 Identities = 18/72 (25%), Positives = 30/72 (41%), Gaps = 2/72 (2%) Frame = +2 Query: 380 DQREYQRELERNLQRLAASLQPLLQHPPSHAALLSNGVNKVDYK--FQA*TRIGLEFCYN 553 ++REY++ E + +R + P + LSN N +Y + YN Sbjct: 52 NEREYRKYRETSKERSRDRTERERSREPKIISSLSNNYNYSNYNNYNNNYNNYNKKLYYN 111 Query: 554 CNNISRIRVNIP 589 N I +I V +P Sbjct: 112 INYIEQIPVPVP 123 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/29 (34%), Positives = 11/29 (37%) Frame = +1 Query: 208 HHHRQPGAARARAGVPSAGG*RHAAPHPP 294 H H P A + G H PHPP Sbjct: 442 HQHSTPLAHSSYPAAIQIGHTPHHHPHPP 470 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,000 Number of Sequences: 438 Number of extensions: 2513 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -