BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0673 (578 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL021492-6|CAA16387.1| 188|Caenorhabditis elegans Hypothetical ... 194 4e-50 U38377-2|AAN72421.1| 199|Caenorhabditis elegans Sox (mammalian ... 31 0.78 U38377-1|AAA79747.2| 283|Caenorhabditis elegans Sox (mammalian ... 31 0.78 U40415-6|AAP68933.1| 329|Caenorhabditis elegans Homolog of yeas... 29 3.2 AF067623-1|AAC17553.2| 640|Caenorhabditis elegans Hypothetical ... 27 7.3 >AL021492-6|CAA16387.1| 188|Caenorhabditis elegans Hypothetical protein Y45F10D.12 protein. Length = 188 Score = 194 bits (473), Expect = 4e-50 Identities = 100/177 (56%), Positives = 125/177 (70%), Gaps = 2/177 (1%) Frame = +1 Query: 1 EHDRKVRRTEVKSQDIXXXXXXXXXXXXXXXTNAKFNQIVLRRLFMSRINRPPISVSRLA 180 +HDR RRT KS++ T KFN IVL+RL MSR NR P+S+++LA Sbjct: 8 KHDRVARRTAPKSENPYLRLLSKLYAFLARRTGEKFNAIVLKRLRMSRRNRQPLSLAKLA 67 Query: 181 RHMKKPTREGLIAVVVGTVTNDVRLYKIPKMTVAALHVTEKARARILAAGGEILTFDQLA 360 R ++K E V + TVT+D RLY +PK++VAALHVTE ARARILAAGGEI+T DQLA Sbjct: 68 RAVQKAGNENKTVVTLSTVTDDARLYTVPKISVAALHVTEGARARILAAGGEIITLDQLA 127 Query: 361 LRAPTGKKTVLVQGQRNAREAVRHFGPAPGAPRSHTKPYVRTKGH--EKARPSRRAN 525 L++P G+ TV +QG R+AREA +HFGPAPG P SHTKPYVR+KG E+AR RRA+ Sbjct: 128 LKSPKGENTVFLQGPRSAREAEKHFGPAPGVPHSHTKPYVRSKGRKFERAR-GRRAS 183 >U38377-2|AAN72421.1| 199|Caenorhabditis elegans Sox (mammalian sry box) familyprotein 2, isoform b protein. Length = 199 Score = 30.7 bits (66), Expect = 0.78 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +3 Query: 105 IQSDRSTPALYEPYQPATNLCVSFGAPHEEANS*GFDCR-GSGDSHK*RETVQDTED 272 + +D S+P+ ++P +TN S+ P E++ G D G+ DS + R T+D Sbjct: 116 VPTDNSSPSQFQPSPMSTNFAGSYLTPKSESSPVGSDSTVGTVDSSQFRAYYDHTKD 172 >U38377-1|AAA79747.2| 283|Caenorhabditis elegans Sox (mammalian sry box) familyprotein 2, isoform a protein. Length = 283 Score = 30.7 bits (66), Expect = 0.78 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +3 Query: 105 IQSDRSTPALYEPYQPATNLCVSFGAPHEEANS*GFDCR-GSGDSHK*RETVQDTED 272 + +D S+P+ ++P +TN S+ P E++ G D G+ DS + R T+D Sbjct: 200 VPTDNSSPSQFQPSPMSTNFAGSYLTPKSESSPVGSDSTVGTVDSSQFRAYYDHTKD 256 >U40415-6|AAP68933.1| 329|Caenorhabditis elegans Homolog of yeast longevity geneprotein 2 protein. Length = 329 Score = 28.7 bits (61), Expect = 3.2 Identities = 14/56 (25%), Positives = 26/56 (46%) Frame = +2 Query: 278 WLLFMLPKKLVHAFWLLEEKFLLLISWLFVLRLARRQYWYKVSEMLVRQCVTLALL 445 W +P + +W+ ++ L+ + L R +W +MLV +TLAL+ Sbjct: 125 WPFHPIPNAVAWYYWIQGGFYIALVFGILFLDAKRSDFW----QMLVHHFITLALI 176 >AF067623-1|AAC17553.2| 640|Caenorhabditis elegans Hypothetical protein T26C12.1 protein. Length = 640 Score = 27.5 bits (58), Expect = 7.3 Identities = 21/75 (28%), Positives = 32/75 (42%), Gaps = 1/75 (1%) Frame = +1 Query: 208 GLIAVVVGT-VTNDVRLYKIPKMTVAALHVTEKARARILAAGGEILTFDQLALRAPTGKK 384 G+ AV G +TN + K +M + L + A +L G + DQ+ L P K Sbjct: 120 GVAAVTAGPGLTNTITAVKNAQMAESPLLLIGGAAPTLLKGRGALQDIDQMVLFRPLCKY 179 Query: 385 TVLVQGQRNAREAVR 429 V+ R+ VR Sbjct: 180 VARVERLRDIVPTVR 194 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,706,587 Number of Sequences: 27780 Number of extensions: 309795 Number of successful extensions: 862 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 797 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 861 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1205362812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -