BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0662 (655 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 26 1.2 CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 24 4.8 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 4.8 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 23 6.4 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 25.8 bits (54), Expect = 1.2 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -1 Query: 268 LWSIYSKYCDNKSSIRHLNIVCFHYTILQCYCYGIVCPDNLS 143 LWS Y D K I+HL++V I +G +CP ++ Sbjct: 1449 LWSEYDP--DAKGRIKHLDVVTLLRKISPPLGFGKLCPHRVA 1488 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 23.8 bits (49), Expect = 4.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 435 GTREQLQNSHPNEQTFEHRE 494 GT +Q+ NSHP E +E Sbjct: 33 GTDQQMANSHPEEPIVVEKE 52 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.8 bits (49), Expect = 4.8 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +1 Query: 319 EDDCGSCHTNRSGSRSRQ-DKSKVCPAAD 402 ED C +C + SGS+ Q ++ CP D Sbjct: 981 EDGCHACDCDPSGSKGSQCNQYGQCPCND 1009 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 23.4 bits (48), Expect = 6.4 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 271 YRELRHDNVQNEINVLEDDCGSCH 342 Y+E D+ +N ++VLE D SCH Sbjct: 419 YQEWVQDSCRNIVHVLE-DIPSCH 441 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 653,222 Number of Sequences: 2352 Number of extensions: 14250 Number of successful extensions: 59 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -