BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0661 (650 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92822-5|CAD45612.3| 743|Caenorhabditis elegans Hypothetical pr... 29 3.8 Z92822-4|CAD18893.2| 791|Caenorhabditis elegans Hypothetical pr... 29 3.8 Z92822-3|CAB07302.3| 774|Caenorhabditis elegans Hypothetical pr... 29 3.8 Z92822-2|CAB70188.2| 850|Caenorhabditis elegans Hypothetical pr... 29 3.8 Z73972-4|CAA98260.1| 666|Caenorhabditis elegans Hypothetical pr... 29 3.8 Z70268-2|CAA94218.1| 98|Caenorhabditis elegans Hypothetical pr... 29 3.8 U58084-1|AAC47121.1| 743|Caenorhabditis elegans CUL-2 protein. 29 3.8 AL132949-35|CAI70419.1| 466|Caenorhabditis elegans Hypothetical... 28 5.0 AL132949-34|CAB61101.3| 574|Caenorhabditis elegans Hypothetical... 28 5.0 >Z92822-5|CAD45612.3| 743|Caenorhabditis elegans Hypothetical protein ZK520.4d protein. Length = 743 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 174 LNFRPVSEVWWRQSQSDVYD 115 +N RP++ V W SDVYD Sbjct: 26 INLRPITNVQWHHKFSDVYD 45 >Z92822-4|CAD18893.2| 791|Caenorhabditis elegans Hypothetical protein ZK520.4c protein. Length = 791 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 174 LNFRPVSEVWWRQSQSDVYD 115 +N RP++ V W SDVYD Sbjct: 43 INLRPITNVQWHHKFSDVYD 62 >Z92822-3|CAB07302.3| 774|Caenorhabditis elegans Hypothetical protein ZK520.4b protein. Length = 774 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 174 LNFRPVSEVWWRQSQSDVYD 115 +N RP++ V W SDVYD Sbjct: 26 INLRPITNVQWHHKFSDVYD 45 >Z92822-2|CAB70188.2| 850|Caenorhabditis elegans Hypothetical protein ZK520.4a protein. Length = 850 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 174 LNFRPVSEVWWRQSQSDVYD 115 +N RP++ V W SDVYD Sbjct: 102 INLRPITNVQWHHKFSDVYD 121 >Z73972-4|CAA98260.1| 666|Caenorhabditis elegans Hypothetical protein F15H10.7 protein. Length = 666 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -2 Query: 592 THVFKYHFVAVKAKSAMCKNSICNQRVKTF 503 + +FKYH+ + KS+ KN + Q F Sbjct: 165 SEIFKYHYTQIVPKSSNIKNKVIEQSTSDF 194 >Z70268-2|CAA94218.1| 98|Caenorhabditis elegans Hypothetical protein T21E8.5 protein. Length = 98 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 595 STHVFKYHFVAVKAKSAMC 539 S HVFK HF A++ K A C Sbjct: 47 SLHVFKEHFEAIRRKGAYC 65 >U58084-1|AAC47121.1| 743|Caenorhabditis elegans CUL-2 protein. Length = 743 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 174 LNFRPVSEVWWRQSQSDVYD 115 +N RP++ V W SDVYD Sbjct: 26 INLRPITNVQWHHKFSDVYD 45 >AL132949-35|CAI70419.1| 466|Caenorhabditis elegans Hypothetical protein Y53F4B.27b protein. Length = 466 Score = 28.3 bits (60), Expect = 5.0 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = -3 Query: 642 LPVFLKINKLYHIPLHPLMSSNIISWLSK 556 LP+ K+ + H+P+ P+ + +I+ ++ K Sbjct: 254 LPIHKKLKPVEHLPIRPISTESIVKFIQK 282 >AL132949-34|CAB61101.3| 574|Caenorhabditis elegans Hypothetical protein Y53F4B.27a protein. Length = 574 Score = 28.3 bits (60), Expect = 5.0 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = -3 Query: 642 LPVFLKINKLYHIPLHPLMSSNIISWLSK 556 LP+ K+ + H+P+ P+ + +I+ ++ K Sbjct: 362 LPIHKKLKPVEHLPIRPISTESIVKFIQK 390 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,610,399 Number of Sequences: 27780 Number of extensions: 264110 Number of successful extensions: 468 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -