BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0657 (560 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0603 - 23580283-23580627,23580970-23581174,23581286-235814... 29 2.5 03_05_0967 + 29265465-29266214,29267718-29267944,29268428-292685... 28 4.4 09_02_0372 + 8070452-8071012,8071114-8071221 28 5.9 05_03_0505 + 14773210-14773506 28 5.9 >01_05_0603 - 23580283-23580627,23580970-23581174,23581286-23581407, 23581493-23581675 Length = 284 Score = 29.1 bits (62), Expect = 2.5 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -1 Query: 158 SRPKGCSFCPERVSGGRSFHSLRRTPSSLR 69 S P GCS CPE + G+ ++ T + R Sbjct: 156 SSPHGCSLCPENMCKGKIIERIQATANGKR 185 >03_05_0967 + 29265465-29266214,29267718-29267944,29268428-29268557, 29268651-29268719,29268803-29268946,29269775-29270011, 29270897-29270998,29271131-29271396,29271766-29273410, 29274449-29275018 Length = 1379 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 64 EHRSDEGVRRRE*KERPPDTRSGQKEQPLGRER 162 EH ++ G R R K RPP R+ + E P R+R Sbjct: 895 EHNAEVGARNRN-KMRPPVDRNDRIEDPHARKR 926 >09_02_0372 + 8070452-8071012,8071114-8071221 Length = 222 Score = 27.9 bits (59), Expect = 5.9 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +1 Query: 46 PLAAIQEHRSDEGVRRRE*KERPPDTRSGQKEQPLGRER 162 PLAA E +SDE + E K P E+PL E+ Sbjct: 99 PLAAPMEEQSDEAFLQAEKKHANPPMEEQIDEEPLQEEK 137 >05_03_0505 + 14773210-14773506 Length = 98 Score = 27.9 bits (59), Expect = 5.9 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +1 Query: 349 PDNRNTAIRRKKRTKEI*HNYCFHLIIIF 435 P N + A+R+ KRT+E+ H++ F ++F Sbjct: 17 PPNGSGALRQCKRTEEVCHDFLFFSPLLF 45 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,948,782 Number of Sequences: 37544 Number of extensions: 173866 Number of successful extensions: 451 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 451 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1281410928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -