BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0646 (600 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 22 4.6 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 7.9 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 7.9 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 7.9 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 21.8 bits (44), Expect = 4.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 598 KKIKFWFSIEYVIIPKQNLP 539 K++K WF V K++LP Sbjct: 159 KQVKIWFQNRRVKYKKEDLP 178 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.0 bits (42), Expect = 7.9 Identities = 9/42 (21%), Positives = 19/42 (45%) Frame = -2 Query: 182 HRAYFFNGSFSVLKSPVFSLFTSCSSAFVSARQSALCFFKFS 57 H + + + +LK+P S C+ A +C++ F+ Sbjct: 85 HLDFRNSATAELLKNPSLSSPDECARACREGEPPRICYYHFT 126 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.0 bits (42), Expect = 7.9 Identities = 9/42 (21%), Positives = 19/42 (45%) Frame = -2 Query: 182 HRAYFFNGSFSVLKSPVFSLFTSCSSAFVSARQSALCFFKFS 57 H + + + +LK+P S C+ A +C++ F+ Sbjct: 85 HLDFRNSATAELLKNPSLSSPDECARACREGEPPRICYYHFT 126 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.0 bits (42), Expect = 7.9 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = +1 Query: 322 PHQTAWNYVKCYHEKDPKHALFL*IHNPTQPFHT 423 PH+ Y +C H K + A P FHT Sbjct: 484 PHELCDKYYRCVHGKPTEFAC-----RPGTVFHT 512 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,431 Number of Sequences: 336 Number of extensions: 3005 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15143945 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -