BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0646 (600 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g08310.1 68417.m01372 expressed protein glutamic acid-rich pr... 33 0.14 At5g17930.1 68418.m02102 MA3 domain-containing protein low simil... 32 0.33 At4g19230.2 68417.m02837 cytochrome P450 family protein cytochro... 31 0.44 At4g02710.1 68417.m00366 kinase interacting family protein simil... 31 0.77 At5g17240.1 68418.m02020 SET domain-containing protein contains ... 29 2.4 At5g31412.1 68418.m03722 hypothetical protein contains Pfam doma... 29 3.1 At2g07240.1 68415.m00831 Ulp1 protease family protein contains P... 29 3.1 At1g66130.1 68414.m07505 oxidoreductase N-terminal domain-contai... 28 4.1 At5g64710.2 68418.m08135 expressed protein contains Pfam profile... 28 5.4 At5g64710.1 68418.m08134 expressed protein contains Pfam profile... 28 5.4 At3g04810.2 68416.m00521 protein kinase, putative similar to LST... 28 5.4 At3g04810.1 68416.m00520 protein kinase, putative similar to LST... 28 5.4 At1g33670.1 68414.m04165 leucine-rich repeat family protein cont... 28 5.4 At5g60620.1 68418.m07608 phospholipid/glycerol acyltransferase f... 27 7.2 At3g20860.1 68416.m02637 protein kinase family protein contains ... 27 7.2 At2g04230.1 68415.m00410 F-box family protein contains F-box dom... 27 7.2 >At4g08310.1 68417.m01372 expressed protein glutamic acid-rich protein precursor - Plasmodium falciparum, PIR2:A54514 Length = 504 Score = 33.1 bits (72), Expect = 0.14 Identities = 22/59 (37%), Positives = 30/59 (50%) Frame = +1 Query: 46 DEQKENLKKHRADCLAETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGK 222 D K +K+H CLA + DE N L+T + K + P+K+ A L K KDGK Sbjct: 77 DVHKSFVKQHLVQCLAGAENDETSENSLET-EKKDDVTPVKEAA--ELSKEHTTKKDGK 132 >At5g17930.1 68418.m02102 MA3 domain-containing protein low similarity to SP|Q9P6R9 Cell cycle control protein cwf22 {Schizosaccharomyces pombe}; contains Pfam profile PF02847: MA3 domain Length = 707 Score = 31.9 bits (69), Expect = 0.33 Identities = 26/104 (25%), Positives = 47/104 (45%), Gaps = 2/104 (1%) Frame = +1 Query: 79 ADCLAETKADE--QLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGKFKKDVALAKV 252 A+ +AET E + LK + + N +K C+++ S+ F+K + L + Sbjct: 479 AEDIAETMDAEVVEAQKMLKLAEAQRMNTDSRKAIFCVIMSSEDYID--AFEKLLRL-DL 535 Query: 253 PNAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHEKDPKHAL 384 P +D+ + L++ CL K + T C H+K+ K L Sbjct: 536 PGKQDREIMRVLVECCLQEKAFNKFYTVLASKLCEHDKNHKFTL 579 >At4g19230.2 68417.m02837 cytochrome P450 family protein cytochrome P450, Arabidopsis thaliana; supported by cDNA: gi_15293092_gb_AY050980.1_ Length = 484 Score = 31.5 bits (68), Expect = 0.44 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -3 Query: 382 ERASGLSRGSISRNSRLFGEGCCLCWPGKRQS 287 ERA+G S G +SR C LCWPG R+S Sbjct: 439 ERATGFSMG----HSRFPKTDCPLCWPGSRRS 466 >At4g02710.1 68417.m00366 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1111 Score = 30.7 bits (66), Expect = 0.77 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -3 Query: 463 LDKHVRASYLTLMRYGTVGL-DYVFTRKERASGLSRGSISRNSRLFGEGCCL 311 ++K R+ + L+ L DYVFT +E A +S+G+ + L EG CL Sbjct: 760 IEKLKRSQTIVLLNESIKSLEDYVFTHRESAGEVSKGADLMDEFLKLEGMCL 811 >At5g17240.1 68418.m02020 SET domain-containing protein contains Pfam profile PF00856: SET domain Length = 491 Score = 29.1 bits (62), Expect = 2.4 Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = +1 Query: 163 LKKYALCMLI-KSQLMTKDGKFKKDVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTAW 339 LKK L + + + LMT + KD+ L+ N + L +++ CL + + ++ W Sbjct: 57 LKKGELVLKVPRKALMTTESIIAKDLKLSDAVNLHNSLSSTQILSVCLLYEMSKEKKSFW 116 Query: 340 NYVKCYH 360 Y +H Sbjct: 117 -YPYLFH 122 >At5g31412.1 68418.m03722 hypothetical protein contains Pfam domain, PF04937: Protein of unknown function (DUF 659) Length = 433 Score = 28.7 bits (61), Expect = 3.1 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = +1 Query: 73 HRADCLAETKADEQLVNKLKT-GDFKTENEPLKKYALCMLIKSQLMTKD-GKFKKDVALA 246 H D + E + + K++T GD+K EN L +Y C+L + +D G K + LA Sbjct: 227 HTVDLMLEAISKLPKMGKMQTFGDYKGENLFLNRYESCVLEWCDVCVEDFGPLMKLLRLA 286 Query: 247 KVPN 258 N Sbjct: 287 DGEN 290 >At2g07240.1 68415.m00831 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 928 Score = 28.7 bits (61), Expect = 3.1 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -1 Query: 321 AVAFVGQASVNQLLYFQFVFSIRHFSQS--DVLLEFSVLGHQLRFD 190 +++ VG+AS++ F + +HFS DVL++FS H LR D Sbjct: 691 SISIVGEASLSHKEIFDIIERKKHFSSKVMDVLIKFS--RHLLRTD 734 >At1g66130.1 68414.m07505 oxidoreductase N-terminal domain-containing protein similar to AX110P [Daucus carota] GI:285739; contains Pfam profile PF01408: Oxidoreductase family NAD-binding Rossmann fold Length = 364 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 226 KKDVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTAW 339 KK L + P A+D ++EK+++AC N T W Sbjct: 95 KKKHVLVEKPPAQDATELEKIVEACEYNGVQFMDGTIW 132 >At5g64710.2 68418.m08135 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537 Length = 716 Score = 27.9 bits (59), Expect = 5.4 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 3/73 (4%) Frame = +1 Query: 22 VVLAQALTDEQKENLKKHRADCLAETKADEQLVNKLKTGDFKTENEPLKKYALCMLI--- 192 VV + + K+N K + + ++ ++ V +K D K + EP+K L + Sbjct: 237 VVSVEKMCQNMKQNDKDVKEESHQLQESSQEFVQVMKLMDVKAKEEPVKANQLAITAVDD 296 Query: 193 KSQLMTKDGKFKK 231 S KDG KK Sbjct: 297 VSSFEEKDGFLKK 309 >At5g64710.1 68418.m08134 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537 Length = 841 Score = 27.9 bits (59), Expect = 5.4 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 3/73 (4%) Frame = +1 Query: 22 VVLAQALTDEQKENLKKHRADCLAETKADEQLVNKLKTGDFKTENEPLKKYALCMLI--- 192 VV + + K+N K + + ++ ++ V +K D K + EP+K L + Sbjct: 362 VVSVEKMCQNMKQNDKDVKEESHQLQESSQEFVQVMKLMDVKAKEEPVKANQLAITAVDD 421 Query: 193 KSQLMTKDGKFKK 231 S KDG KK Sbjct: 422 VSSFEEKDGFLKK 434 >At3g04810.2 68416.m00521 protein kinase, putative similar to LSTK-1-like kinase [Lycopersicon esculentum] GI:15637110; contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 578 Score = 27.9 bits (59), Expect = 5.4 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 1/85 (1%) Frame = +1 Query: 16 VCVVLAQALTDEQKENLKKHRADCLAETKADEQLVNKLKTGDFKTENEPLKKYALCMLIK 195 VC+++ + E +KK E K + LV L ++ N L + C I Sbjct: 77 VCIIIGYCKGGDMAEAIKKTNGVHFTEEKLCKWLVQILLALEYLHANHILHRDVKCSNI- 135 Query: 196 SQLMTKDGKFK-KDVALAKVPNAED 267 +TKD + D LAKV ++D Sbjct: 136 --FLTKDQDIRLGDFGLAKVLTSDD 158 >At3g04810.1 68416.m00520 protein kinase, putative similar to LSTK-1-like kinase [Lycopersicon esculentum] GI:15637110; contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 606 Score = 27.9 bits (59), Expect = 5.4 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 1/85 (1%) Frame = +1 Query: 16 VCVVLAQALTDEQKENLKKHRADCLAETKADEQLVNKLKTGDFKTENEPLKKYALCMLIK 195 VC+++ + E +KK E K + LV L ++ N L + C I Sbjct: 77 VCIIIGYCKGGDMAEAIKKTNGVHFTEEKLCKWLVQILLALEYLHANHILHRDVKCSNI- 135 Query: 196 SQLMTKDGKFK-KDVALAKVPNAED 267 +TKD + D LAKV ++D Sbjct: 136 --FLTKDQDIRLGDFGLAKVLTSDD 158 >At1g33670.1 68414.m04165 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to receptor kinase-like protein GB:AAB82755 GI:2586083 from [Oryza longistaminata] (Science 270 (5243), 1804-1806 (1995)) Length = 455 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -1 Query: 258 IRHFSQSDVLLEFSVLGHQLRFD 190 IR F+Q D ++EF G++L+FD Sbjct: 362 IRFFNQMDFMVEFHAPGNKLQFD 384 >At5g60620.1 68418.m07608 phospholipid/glycerol acyltransferase family protein contains Pfam PF01553: Acyltransferase Length = 376 Score = 27.5 bits (58), Expect = 7.2 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = +3 Query: 519 NFNLYLFGKFCFGII 563 N+N+YLF +CFG++ Sbjct: 76 NWNIYLFPLYCFGVV 90 >At3g20860.1 68416.m02637 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 427 Score = 27.5 bits (58), Expect = 7.2 Identities = 22/85 (25%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Frame = +1 Query: 16 VCVVLAQALTDEQKENLKKHRADCLAETKADEQLVNKLKTGDFKTENEPLKKYALCMLIK 195 VC+V + + + +KK R +E K +V L D+ N L + C I Sbjct: 87 VCIVTSYCEGGDMTQMIKKSRGVFASEEKLCRWMVQLLLAIDYLHNNRVLHRDLKCSNI- 145 Query: 196 SQLMTKDGKFK-KDVALAKVPNAED 267 +TK+ + + D LAK+ +D Sbjct: 146 --FLTKENEVRLGDFGLAKLLGKDD 168 >At2g04230.1 68415.m00410 F-box family protein contains F-box domain Pfam:PF00646 Length = 448 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 256 NAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHE 363 ++ KL++ KL D L + +P + WN KC E Sbjct: 333 DSSPKLQILKLTDVYLHDNKTNPDERKWNPPKCAPE 368 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,710,339 Number of Sequences: 28952 Number of extensions: 258124 Number of successful extensions: 724 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 724 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1187288784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -