BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0645 (545 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) 31 0.81 SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) 31 0.81 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 28 5.7 SB_33647| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.8 bits (106), Expect = 1e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -3 Query: 408 DVVAVSQAPSPESNPDSPLPVTTM 337 DVVAVSQAPSPESNP+SP PV TM Sbjct: 105 DVVAVSQAPSPESNPNSPSPVVTM 128 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 41.1 bits (92), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 399 AVSQAPSPESNPDSPLPVTTM 337 AVSQAPSPESNP+SP PV TM Sbjct: 52 AVSQAPSPESNPNSPSPVVTM 72 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.038 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -1 Query: 398 PFLRLPLRNRTLIPRYP 348 PFLRLPLRNRTLI R+P Sbjct: 224 PFLRLPLRNRTLILRHP 240 >SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 33.1 bits (72), Expect = 0.15 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +2 Query: 2 CLSQRLSHACLSASRIKAIPRMA 70 CLSQRLSHACLS S RMA Sbjct: 139 CLSQRLSHACLSISTCTVKLRMA 161 >SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.3 bits (70), Expect = 0.27 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +2 Query: 2 CLSQRLSHACLSASRIKAIPRMA 70 CLSQRLSHACLS S RMA Sbjct: 115 CLSQRLSHACLSISTRTVKLRMA 137 >SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) Length = 1797 Score = 30.7 bits (66), Expect = 0.81 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +3 Query: 6 CLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 131 CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 450 CLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 491 >SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) Length = 1304 Score = 30.7 bits (66), Expect = 0.81 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +3 Query: 6 CLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 131 CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 869 CLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 910 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 27.9 bits (59), Expect = 5.7 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 417 PSLDVVAVSQAPSPESNPDSPLP 349 P+ DV+A Q P P S D PLP Sbjct: 75 PAEDVMAAHQEPKPTSAIDQPLP 97 >SB_33647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 27.5 bits (58), Expect = 7.6 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = +3 Query: 360 NQGSIPEREPEKRLPHPRKAAGAQIT-HSRHG-EVVTKNNDTGLLRGLVIGMSTL 518 N+ +IP+RE E R AAGA I H +H K+ G R L +G L Sbjct: 10 NEKTIPQREVE-RTKKAATAAGASIAEHIKHAIAEQVKHAKPGFSRSLTLGQKLL 63 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,648,493 Number of Sequences: 59808 Number of extensions: 374761 Number of successful extensions: 1007 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 902 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1007 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1252112599 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -