BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0639 (604 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC047749-1|AAH47749.1| 430|Homo sapiens potassium channel, subf... 30 5.4 AF287302-1|AAG32313.1| 430|Homo sapiens tandem pore domain pota... 30 5.4 >BC047749-1|AAH47749.1| 430|Homo sapiens potassium channel, subfamily K, member 12 protein. Length = 430 Score = 30.3 bits (65), Expect = 5.4 Identities = 12/40 (30%), Positives = 25/40 (62%) Frame = -1 Query: 478 YKTAN*KYIYIVAICLIVVYSAIRILIIKLLNCLSQKITC 359 Y+ N +I + C+ +++ I ILI ++LN + +K++C Sbjct: 276 YRLGNFLFILLGVCCIYSLFNVISILIKQVLNWMLRKLSC 315 >AF287302-1|AAG32313.1| 430|Homo sapiens tandem pore domain potassium channel THIK-2 protein. Length = 430 Score = 30.3 bits (65), Expect = 5.4 Identities = 12/40 (30%), Positives = 25/40 (62%) Frame = -1 Query: 478 YKTAN*KYIYIVAICLIVVYSAIRILIIKLLNCLSQKITC 359 Y+ N +I + C+ +++ I ILI ++LN + +K++C Sbjct: 276 YRLGNFLFILLGVCCIYSLFNVISILIKQVLNWMLRKLSC 315 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 59,024,469 Number of Sequences: 237096 Number of extensions: 1042580 Number of successful extensions: 5168 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5168 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6354183230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -