BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0639 (604 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80846-2|AAC70887.3| 516|Caenorhabditis elegans Hypothetical pr... 34 0.090 Z68120-4|CAA92202.1| 328|Caenorhabditis elegans Hypothetical pr... 27 7.8 >U80846-2|AAC70887.3| 516|Caenorhabditis elegans Hypothetical protein K06A9.2 protein. Length = 516 Score = 33.9 bits (74), Expect = 0.090 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -2 Query: 600 FIQIDENVPFLLNKTHSRLNKLTNIDRKNVKF 505 F + ++ F+LN RL + TN DRKNV+F Sbjct: 56 FFRYQDDYLFILNNLPDRLQETTNFDRKNVRF 87 >Z68120-4|CAA92202.1| 328|Caenorhabditis elegans Hypothetical protein T24C2.4 protein. Length = 328 Score = 27.5 bits (58), Expect = 7.8 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +2 Query: 497 YRPNLTFFLSILVNLFNLECVLFNKNGTFSSICINK 604 YR NL L +N FNL FN N TF ++K Sbjct: 116 YR-NLVTLLKYKINTFNLSYWFFNNNPTFRDTELSK 150 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,075,625 Number of Sequences: 27780 Number of extensions: 183052 Number of successful extensions: 486 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 486 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1289949676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -