BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0638 (690 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6G2D6 Cluster: Putative uncharacterized protein; n=1; ... 34 3.8 UniRef50_A5M343 Cluster: Putative uncharacterized protein; n=1; ... 33 6.6 >UniRef50_Q6G2D6 Cluster: Putative uncharacterized protein; n=1; Bartonella henselae|Rep: Putative uncharacterized protein - Bartonella henselae (Rochalimaea henselae) Length = 323 Score = 33.9 bits (74), Expect = 3.8 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -3 Query: 463 GFFLFFSGPPQFSRIYLGVISFHF 392 GF +FF+ PPQ I+ G+IS HF Sbjct: 30 GFIVFFNSPPQTIEIHRGIISSHF 53 >UniRef50_A5M343 Cluster: Putative uncharacterized protein; n=1; Streptococcus pneumoniae SP11-BS70|Rep: Putative uncharacterized protein - Streptococcus pneumoniae SP11-BS70 Length = 72 Score = 33.1 bits (72), Expect = 6.6 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +3 Query: 441 PEKKRKKPHPATLFLFSHRYFC-TFIDTKRLIIHNYKFNPEEIYNYQNK 584 P+KK K + F+ + F T IDTK ++++NY ++Y+ + K Sbjct: 16 PQKKLKNKEESYFFVIYNNMFSNTLIDTKLILLYNYLMEVSDLYSIRLK 64 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 611,963,610 Number of Sequences: 1657284 Number of extensions: 11729595 Number of successful extensions: 29442 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29428 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54132236449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -