BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0638 (690 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long fo... 25 2.3 DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist mic... 24 3.9 >AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long form protein. Length = 311 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = -2 Query: 509 CAKVPMGKKKQSRWMWLLPLLLGSSAIFPNLLGCYFISFHFV 384 CAK +G + + + L SA F N + C F F ++ Sbjct: 178 CAKKALGANGKEGYKKIRDYELADSAEFRNAMDCVFRGFRYM 219 >DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist michelob_x protein. Length = 201 Score = 24.2 bits (50), Expect = 3.9 Identities = 8/28 (28%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = +3 Query: 429 NCGGPEKKRKKPHPATLF--LFSHRYFC 506 + P+KK++KP P ++ + + Y+C Sbjct: 142 SASAPKKKKRKPKPPRIYNNNYYYNYYC 169 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 639,451 Number of Sequences: 2352 Number of extensions: 12475 Number of successful extensions: 34 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -