BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0637 (626 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 24 1.1 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 24 1.1 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 5.6 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 5.6 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 5.6 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 7.4 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 7.4 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 9.8 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 9.8 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 9.8 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 24.2 bits (50), Expect = 1.1 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -3 Query: 534 HVGRCVVEQCFLVVRLXGPCC 472 H+G ++ L++ L G CC Sbjct: 57 HIGLAIIYSMLLIMSLVGNCC 77 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 24.2 bits (50), Expect = 1.1 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -3 Query: 534 HVGRCVVEQCFLVVRLXGPCC 472 H+G ++ L++ L G CC Sbjct: 57 HIGLAIIYSMLLIMSLVGNCC 77 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.6 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +3 Query: 183 YFISRMNPYSPELNYF 230 Y++ + P P+LNY+ Sbjct: 182 YYLHQFAPEQPDLNYY 197 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.8 bits (44), Expect = 5.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 449 IDGQSPHVVKSRIKWQTGA 393 I+ S H K R++W TGA Sbjct: 134 IESFSYHKQKLRLRWGTGA 152 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.6 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +3 Query: 183 YFISRMNPYSPELNYF 230 Y++ + P P+LNY+ Sbjct: 182 YYLHQFAPEQPDLNYY 197 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 409 NGRPVLIHKNMSVPRLLPDVQ 347 NGR I + M+ RLLP V+ Sbjct: 28 NGREDQIPREMNTERLLPYVE 48 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 409 NGRPVLIHKNMSVPRLLPDVQ 347 NGR I + M+ RLLP V+ Sbjct: 28 NGREDQIPREMNTERLLPYVE 48 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.0 bits (42), Expect = 9.8 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +2 Query: 215 RAQLFPVLSVLQIIRSSTGIVRDEGEGRFDNDLSN 319 ++ L P L+ Q +++TG+ R DN +N Sbjct: 337 KSTLTPKLARKQFQKNTTGLERSRSWSSLDNTNTN 371 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 Query: 288 EKADSITTYLTNAGYNKYDFWTSGNN 365 E+ ++T + T Y+KYD + NN Sbjct: 102 EQRCTVTMHGTVQSYDKYDLLENVNN 127 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 396 TGLPFNATFNYMR 434 TGLPF TFN ++ Sbjct: 932 TGLPFVYTFNVIK 944 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,015 Number of Sequences: 438 Number of extensions: 3783 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18704709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -