BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0635 (401 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2676| Best HMM Match : Kelch_1 (HMM E-Value=0) 52 1e-07 SB_56342| Best HMM Match : Kelch_1 (HMM E-Value=0) 50 9e-07 SB_8385| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_33725| Best HMM Match : Kelch_1 (HMM E-Value=3.59994e-42) 48 3e-06 SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) 48 4e-06 SB_55145| Best HMM Match : Kelch_1 (HMM E-Value=0) 47 5e-06 SB_13053| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 7e-06 SB_54322| Best HMM Match : Kelch_1 (HMM E-Value=0) 46 9e-06 SB_28350| Best HMM Match : BTB (HMM E-Value=1.1e-38) 46 2e-05 SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) 46 2e-05 SB_48518| Best HMM Match : Kelch_1 (HMM E-Value=0) 44 4e-05 SB_5771| Best HMM Match : Kelch_1 (HMM E-Value=0) 44 4e-05 SB_39453| Best HMM Match : BTB (HMM E-Value=3.1e-36) 44 4e-05 SB_38111| Best HMM Match : Kelch_1 (HMM E-Value=0) 44 5e-05 SB_33742| Best HMM Match : Kelch_1 (HMM E-Value=0) 44 5e-05 SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-05 SB_36233| Best HMM Match : Kelch_1 (HMM E-Value=0) 42 1e-04 SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) 42 1e-04 SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) 42 2e-04 SB_2806| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_45623| Best HMM Match : BTB (HMM E-Value=1.4e-36) 41 4e-04 SB_4030| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 4e-04 SB_33388| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 6e-04 SB_38405| Best HMM Match : BACK (HMM E-Value=0) 40 6e-04 SB_18403| Best HMM Match : BACK (HMM E-Value=0) 40 6e-04 SB_40807| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 8e-04 SB_37574| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 8e-04 SB_55494| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.002 SB_663| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.002 SB_49953| Best HMM Match : BTB (HMM E-Value=2.9e-18) 38 0.003 SB_35938| Best HMM Match : BTB (HMM E-Value=8.5e-24) 38 0.003 SB_38976| Best HMM Match : BACK (HMM E-Value=3.09967e-42) 37 0.007 SB_26836| Best HMM Match : BTB (HMM E-Value=1.1e-37) 36 0.012 SB_44086| Best HMM Match : BTB (HMM E-Value=1.8e-23) 36 0.012 SB_18446| Best HMM Match : Kelch_1 (HMM E-Value=0) 35 0.029 SB_6593| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.038 SB_3363| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.038 SB_54052| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.050 SB_13953| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.066 SB_32554| Best HMM Match : BTB (HMM E-Value=2e-13) 33 0.066 SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.066 SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.087 SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.10 SB_48929| Best HMM Match : BTB (HMM E-Value=1.4e-15) 33 0.12 SB_12977| Best HMM Match : BTB (HMM E-Value=1.7e-30) 32 0.20 SB_8489| Best HMM Match : Kelch_1 (HMM E-Value=1.2e-30) 31 0.27 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 31 0.27 SB_40853| Best HMM Match : BTB (HMM E-Value=1.4e-17) 31 0.35 SB_37935| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.61 SB_34423| Best HMM Match : 7tm_2 (HMM E-Value=6e-07) 30 0.61 SB_53179| Best HMM Match : BTB (HMM E-Value=3.3e-21) 29 1.4 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_9607| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_30894| Best HMM Match : BTB (HMM E-Value=3.1e-14) 29 1.9 SB_27263| Best HMM Match : Kelch_1 (HMM E-Value=2.10055e-42) 29 1.9 SB_29786| Best HMM Match : I-set (HMM E-Value=0) 28 2.5 SB_40708| Best HMM Match : SRCR (HMM E-Value=0) 28 2.5 SB_6010| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.5 SB_39167| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.3 SB_45209| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.3 SB_26166| Best HMM Match : Mito_carr (HMM E-Value=0) 28 3.3 SB_56853| Best HMM Match : BTB (HMM E-Value=1.1e-16) 27 4.3 SB_58957| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_51788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_25029| Best HMM Match : Collagen (HMM E-Value=0.38) 27 7.6 SB_2411| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 10.0 SB_48717| Best HMM Match : DUF963 (HMM E-Value=3.2e-05) 26 10.0 SB_13923| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 10.0 >SB_2676| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 645 Score = 52.4 bits (120), Expect = 1e-07 Identities = 26/74 (35%), Positives = 42/74 (56%), Gaps = 2/74 (2%) Frame = +2 Query: 185 GFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMN--PTQHPIVFLKDVSH 358 G + L R +L DV L + AH++VLS CS YF MF N ++ ++++K + Sbjct: 21 GLNQLRQRKELCDVELCVGNVQISAHRVVLSACSAYFDAMFTGNLLESKKQVIYIKGIDE 80 Query: 359 SALRDLLQFMYQGE 400 +AL+ L+ F Y G+ Sbjct: 81 TALQLLVDFAYTGK 94 >SB_56342| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 651 Score = 49.6 bits (113), Expect = 9e-07 Identities = 30/93 (32%), Positives = 48/93 (51%), Gaps = 2/93 (2%) Frame = +2 Query: 125 MASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEM 304 MAS++ C +F + + + L S L DVTL + R L +H++VL+ SPYF M Sbjct: 1 MASEDGLLFCVPDFPTKVFSSLNELRSEEKLCDVTLVVKDRSLVSHRVVLAGWSPYFHAM 60 Query: 305 F--KMNPTQHPIVFLKDVSHSALRDLLQFMYQG 397 M ++ V + + +AL +L+ F Y G Sbjct: 61 LTGDMLESRLEKVTIHGIECAALEELINFCYTG 93 >SB_8385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 580 Score = 48.0 bits (109), Expect = 3e-06 Identities = 29/84 (34%), Positives = 47/84 (55%), Gaps = 3/84 (3%) Frame = +2 Query: 158 NNFHANMSAG-FHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQH 328 NN H N + + L + L DV L A + AH++VL+ SPYF MF +++ ++ Sbjct: 20 NNEHCNKAFQVMNSLRQQNMLCDVVLKAGSIEIPAHRVVLASSSPYFFAMFTGELSESRQ 79 Query: 329 PIVFLKDVSHSALRDLLQFMYQGE 400 +V LK++ AL L++F+Y E Sbjct: 80 TVVTLKEIDSLALELLIEFVYIAE 103 >SB_33725| Best HMM Match : Kelch_1 (HMM E-Value=3.59994e-42) Length = 635 Score = 48.0 bits (109), Expect = 3e-06 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 2/64 (3%) Frame = +2 Query: 215 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFM 388 L DV L EG AH+LVL+ SP+F +F +M Q + LK V S + ++L+++ Sbjct: 33 LCDVDLMVEGLTFSAHRLVLAAGSPFFHGLFTTEMKEKQENKIVLKQVKASVMENVLEYL 92 Query: 389 YQGE 400 Y G+ Sbjct: 93 YTGK 96 >SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 823 Score = 47.6 bits (108), Expect = 4e-06 Identities = 22/62 (35%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Frame = +2 Query: 212 DLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQF 385 +L DV + + AH++VL+ CSPYF+ MF +M ++ + ++DV SA+ L+ F Sbjct: 57 ELCDVVIKVGSSTIHAHRVVLAACSPYFRAMFTREMAESRQAEITIRDVDESAMNLLITF 116 Query: 386 MY 391 Y Sbjct: 117 AY 118 >SB_55145| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 625 Score = 47.2 bits (107), Expect = 5e-06 Identities = 23/67 (34%), Positives = 39/67 (58%), Gaps = 2/67 (2%) Frame = +2 Query: 197 LLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALR 370 LL + L DVT+ A R ++ H++VL+ CS YF MF M + ++ ++ +S ++ Sbjct: 27 LLEQEKLCDVTIKAGERKIRCHRVVLASCSAYFHSMFTNSMLESSQEVITIQGLSEKSVI 86 Query: 371 DLLQFMY 391 L+ FMY Sbjct: 87 QLINFMY 93 >SB_13053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 581 Score = 46.8 bits (106), Expect = 7e-06 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 3/74 (4%) Frame = +2 Query: 188 FHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMN---PTQHPIVFLKDVSH 358 F+ + +L DV L + + +HKLVL+ SPYF+ MF N TQ I L D+ Sbjct: 23 FNDFRNSKELCDVLLCVDDEEIPSHKLVLAASSPYFRAMFTSNLLECTQRTIT-LYDIDV 81 Query: 359 SALRDLLQFMYQGE 400 AL+ ++++ Y G+ Sbjct: 82 GALQQIVEYFYTGK 95 >SB_54322| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 587 Score = 46.4 bits (105), Expect = 9e-06 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 2/64 (3%) Frame = +2 Query: 215 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFM 388 L DVTL EG+ AH++VL+ S YF +F +M P V L+++ S + +L ++ Sbjct: 29 LCDVTLVVEGKEFPAHRIVLAASSKYFYGLFTSEMIEKNAPSVKLQELRASVMNHILTYL 88 Query: 389 YQGE 400 Y GE Sbjct: 89 YTGE 92 >SB_28350| Best HMM Match : BTB (HMM E-Value=1.1e-38) Length = 518 Score = 45.6 bits (103), Expect = 2e-05 Identities = 19/39 (48%), Positives = 28/39 (71%) Frame = +2 Query: 188 FHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEM 304 F L G+L+DVTL +G ++AH++VL+ CSPYF+ M Sbjct: 29 FKELRDDGELLDVTLHVQGEEIKAHRVVLAACSPYFRAM 67 >SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 590 Score = 45.6 bits (103), Expect = 2e-05 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 2/91 (2%) Frame = +2 Query: 134 DEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF-- 307 D+ F+ + + + + L G + DV + AE AH+ +LS S YF MF Sbjct: 6 DDSFTFYDDKYSKAILHRINQLRHHGAMCDVVIKAEDTEFLAHRNILSASSDYFFAMFNG 65 Query: 308 KMNPTQHPIVFLKDVSHSALRDLLQFMYQGE 400 M + +V + V+ ++R +L F+Y GE Sbjct: 66 NMKESSQDVVTITGVTPDSMRSILNFIYTGE 96 >SB_48518| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 481 Score = 44.4 bits (100), Expect = 4e-05 Identities = 28/70 (40%), Positives = 37/70 (52%), Gaps = 2/70 (2%) Frame = +2 Query: 197 LLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALR 370 L R L DVTL R + AH+LVL+ S YFQ MF + + V L+DV A+ Sbjct: 40 LRGRKQLCDVTLCVGERQIVAHRLVLASFSSYFQAMFTGGLVESFEDSVTLRDVDSGAVE 99 Query: 371 DLLQFMYQGE 400 L+ F Y G+ Sbjct: 100 LLVDFAYTGK 109 >SB_5771| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 595 Score = 44.4 bits (100), Expect = 4e-05 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = +2 Query: 215 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMN-PTQHPIVFLKDVSHSALRDLLQFMY 391 L DV L +G AHK +L+ S YF MF + T V +++++ +A+ LL F+Y Sbjct: 33 LTDVVLIVDGHEFPAHKNILAASSDYFMAMFSGHMATVDRTVVVQEITSTAMEVLLAFIY 92 Query: 392 QGE 400 QG+ Sbjct: 93 QGK 95 >SB_39453| Best HMM Match : BTB (HMM E-Value=3.1e-36) Length = 398 Score = 44.4 bits (100), Expect = 4e-05 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 2/76 (2%) Frame = +2 Query: 176 MSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKD 349 +S+ LL D L A GR +AHK +L+ SP F MF +M ++ V + D Sbjct: 209 LSSHMGNLLDNATFSDTVLIAGGREFKAHKAILAARSPVFSAMFEHEMEESRKGRVEILD 268 Query: 350 VSHSALRDLLQFMYQG 397 + +++L+F+Y G Sbjct: 269 IDPDVFQEMLKFVYTG 284 >SB_38111| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 548 Score = 44.0 bits (99), Expect = 5e-05 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 3/64 (4%) Frame = +2 Query: 215 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMN---PTQHPIVFLKDVSHSALRDLLQF 385 L +VT+ G+ AH+ VL+ SPYF+ MF + + V L++++ + +LL F Sbjct: 49 LCEVTIVVNGKPFYAHRNVLAAASPYFRAMFSSHFREQNESKPVILENITADVMEELLNF 108 Query: 386 MYQG 397 +Y G Sbjct: 109 IYAG 112 >SB_33742| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 570 Score = 44.0 bits (99), Expect = 5e-05 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 3/64 (4%) Frame = +2 Query: 215 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMN---PTQHPIVFLKDVSHSALRDLLQF 385 L +VT+ G+ AH+ VL+ SPYF+ MF + + V L++++ + +LL F Sbjct: 49 LCEVTIVVNGKPFYAHRNVLAAASPYFRAMFSSHFREQNESKPVILENITADVMEELLNF 108 Query: 386 MYQG 397 +Y G Sbjct: 109 IYAG 112 >SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 43.6 bits (98), Expect = 6e-05 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = +2 Query: 209 GDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQ 382 G L DV L E + AH++VL+ CS YF MF M +Q ++ L+ ++ + LL Sbjct: 35 GKLCDVVLQVEKKEFPAHRIVLASCSDYFYAMFTNDMLESQKGVIELQGLASDTMEVLLD 94 Query: 383 FMY 391 F+Y Sbjct: 95 FVY 97 >SB_36233| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 571 Score = 42.3 bits (95), Expect = 1e-04 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Frame = +2 Query: 215 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFM 388 L DVTL L AH+ +L+ SPYF+ +F +M Q + L +V + D+L ++ Sbjct: 25 LCDVTLNVNEVLFHAHRNILAASSPYFRALFTSEMRENQGNEIKLNNVDVEIMEDILAYL 84 Query: 389 YQG 397 Y G Sbjct: 85 YSG 87 >SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) Length = 1463 Score = 42.3 bits (95), Expect = 1e-04 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Frame = +2 Query: 215 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFM 388 L DVTL L AH+ +L+ SPYF+ +F +M Q + L +V + D+L ++ Sbjct: 1394 LCDVTLNVNEVLFHAHRNILAASSPYFRALFTSEMRENQGNEIKLNNVDVEIMEDILAYL 1453 Query: 389 YQG 397 Y G Sbjct: 1454 YSG 1456 >SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) Length = 554 Score = 41.9 bits (94), Expect = 2e-04 Identities = 23/64 (35%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Frame = +2 Query: 209 GDLVDVTLAAE-GRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLL 379 G DV L E G+ + AHKLVLS S YF+ MF M +Q + ++ + ++ L+ Sbjct: 23 GIFCDVVLMTEDGQEIDAHKLVLSASSEYFRAMFLTDMKESQQKFITIRAIDSQSMTTLV 82 Query: 380 QFMY 391 +F Y Sbjct: 83 EFAY 86 >SB_2806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 600 Score = 41.1 bits (92), Expect = 3e-04 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 2/73 (2%) Frame = +2 Query: 188 FHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHS 361 F L D+ + + ++AHKLVL+ S YF MF M T V L D+ + Sbjct: 24 FEDFRKNSQLCDIKIVIGDKRIRAHKLVLASFSDYFSAMFTGDMAETSQNTVHLTDMDPA 83 Query: 362 ALRDLLQFMYQGE 400 A++ L+ + Y E Sbjct: 84 AVQALISYSYTSE 96 >SB_45623| Best HMM Match : BTB (HMM E-Value=1.4e-36) Length = 574 Score = 40.7 bits (91), Expect = 4e-04 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +2 Query: 215 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFM 388 L DV L E AHK +L+ S YF MF M + V LK + S ++++L F+ Sbjct: 40 LCDVVLLVENEEFSAHKGILAANSHYFMAMFTTDMIEKEQERVILKKLKPSVVKEILDFL 99 Query: 389 YQG 397 Y G Sbjct: 100 YTG 102 >SB_4030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 809 Score = 40.7 bits (91), Expect = 4e-04 Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 3/81 (3%) Frame = +2 Query: 158 NNFHA-NMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFK--MNPTQH 328 ++FHA N+ L + DVT+ + +H+L+L+ S YF MF M+ T Sbjct: 15 DSFHACNVLETLRTLFQGRKMCDVTVVVGKMEIPSHRLILAANSSYFYSMFTSGMSETAQ 74 Query: 329 PIVFLKDVSHSALRDLLQFMY 391 + LK+V + +R L+++ Y Sbjct: 75 NRINLKEVDATVVRQLIEYCY 95 >SB_33388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 658 Score = 40.3 bits (90), Expect = 6e-04 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +2 Query: 221 DVTLAAEGRLLQAHKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQ 394 DV L EGR H+ VL+ SP+F MF M + + L+ + A+ +L+F Y Sbjct: 57 DVILQVEGRHYPVHRCVLAANSPFFYTMFNSGMKESMQQTLQLQSIKAKAMESILEFFYT 116 Query: 395 GE 400 E Sbjct: 117 QE 118 >SB_38405| Best HMM Match : BACK (HMM E-Value=0) Length = 423 Score = 40.3 bits (90), Expect = 6e-04 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 2/62 (3%) Frame = +2 Query: 212 DLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQF 385 +L DV L R + AH+LVL+ CS YF MF ++ ++ + L+ + A+ L++F Sbjct: 40 ELCDVVLLVGDRRIYAHRLVLAACSQYFHAMFTSELLESRQKEISLQGLQPDAMELLVEF 99 Query: 386 MY 391 Y Sbjct: 100 AY 101 >SB_18403| Best HMM Match : BACK (HMM E-Value=0) Length = 423 Score = 40.3 bits (90), Expect = 6e-04 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 2/62 (3%) Frame = +2 Query: 212 DLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQF 385 +L DV L R + AH+LVL+ CS YF MF ++ ++ + L+ + A+ L++F Sbjct: 40 ELCDVVLLVGDRRIYAHRLVLAACSQYFHAMFTSELLESRQKEISLQGLQPDAMELLVEF 99 Query: 386 MY 391 Y Sbjct: 100 AY 101 >SB_40807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 39.9 bits (89), Expect = 8e-04 Identities = 27/101 (26%), Positives = 48/101 (47%), Gaps = 5/101 (4%) Frame = +2 Query: 113 VVAIMASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPY 292 ++A S Q S+C +++ F LL DV L G A+K +LS Y Sbjct: 78 LIAQKDSITQSSICRQPV-SSLKKDFQELLENAYCSDVVLLYSGSRFHANKAILSARCSY 136 Query: 293 FQEMFKMNPTQHPIVF-----LKDVSHSALRDLLQFMYQGE 400 F++MF + + P+ + ++++S LLQ++Y G+ Sbjct: 137 FKDMFS-DESNQPLTYSVDIPVEEISTGMFASLLQYLYTGD 176 Score = 26.2 bits (55), Expect = 10.0 Identities = 16/63 (25%), Positives = 27/63 (42%) Frame = +2 Query: 149 LCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQH 328 L +N H++ F G VD ++ + HK VL SPYF+ + + Sbjct: 210 LLYNADHSDTLLVFQGFNLSELPVDSSVTETCFEVPCHKAVLCARSPYFRSLLLKKDSSF 269 Query: 329 PIV 337 P++ Sbjct: 270 PVL 272 >SB_37574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 39.9 bits (89), Expect = 8e-04 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = +2 Query: 215 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFM 388 L DV L + + H+ VL+ CS YF MF ++ ++ I+ +KD+ ++ L++F Sbjct: 11 LCDVVLRIDEQSYAGHRAVLASCSAYFYAMFNGELAESKQKIITMKDILPDYMQVLVEFA 70 Query: 389 YQG 397 Y G Sbjct: 71 YTG 73 >SB_55494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 664 Score = 38.3 bits (85), Expect = 0.002 Identities = 20/72 (27%), Positives = 35/72 (48%) Frame = +2 Query: 113 VVAIMASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPY 292 V A+ Q S NF A + ++ ++ DVT EG HK++L+ SP Sbjct: 458 VFAVFEDAVQHSKSSKNFGIYTGADY---VNNQEMSDVTFVVEGEPFYGHKIILATASPR 514 Query: 293 FQEMFKMNPTQH 328 F++M + P+++ Sbjct: 515 FKQMLTIKPSEN 526 >SB_663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2028 Score = 38.3 bits (85), Expect = 0.002 Identities = 24/53 (45%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +2 Query: 245 RLLQAHKLVLSVCSPYFQEMFKMN-PTQHPIVFLKDVSHSALRDLLQFMYQGE 400 R + AHK VLS+ S F MF TQ V L DV SA LL+F+Y E Sbjct: 1622 RRIPAHKFVLSIGSAVFDAMFNGGIATQSDEVELPDVEPSAFMALLRFLYTDE 1674 >SB_49953| Best HMM Match : BTB (HMM E-Value=2.9e-18) Length = 123 Score = 37.9 bits (84), Expect = 0.003 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 3/62 (4%) Frame = +2 Query: 221 DVTLAAEGRLLQAHKLVLSVCSPYFQEMF---KMNPTQHPIVFLKDVSHSALRDLLQFMY 391 D+TL A +L AH++VL+ SPYF+E+ + V + A+ +L+F Y Sbjct: 42 DITLKAGNLVLSAHRVVLAALSPYFRELLLPTNNEKAEKEYVMPDSLKPGAVVAMLEFFY 101 Query: 392 QG 397 G Sbjct: 102 SG 103 >SB_35938| Best HMM Match : BTB (HMM E-Value=8.5e-24) Length = 467 Score = 37.9 bits (84), Expect = 0.003 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +2 Query: 257 AHKLVLSVCSPYFQEMFKMNPTQH-PIVFLKDVSHSALRDLLQFMY 391 AHK VLSV SP F+ MF N + P V L D + ++LL+++Y Sbjct: 45 AHKFVLSVSSPVFEAMFFGNLAESGPTVRLPDCTVDGFQELLRYLY 90 >SB_38976| Best HMM Match : BACK (HMM E-Value=3.09967e-42) Length = 603 Score = 36.7 bits (81), Expect = 0.007 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +2 Query: 221 DVTLAAEGRLLQAHKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQ 394 DV L EG++ AH+ VL+ S +F MF M + + L ++ AL +L F Y Sbjct: 53 DVNLEVEGQVFAAHRCVLAANSQFFYTMFTSGMRDSNDSRIKLCSLTSGALSSILDFFYT 112 Query: 395 GE 400 E Sbjct: 113 RE 114 >SB_26836| Best HMM Match : BTB (HMM E-Value=1.1e-37) Length = 521 Score = 35.9 bits (79), Expect = 0.012 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = +2 Query: 215 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFM 388 + D L E + HK+V+S SPYF+ +F + + V ++ + LL F+ Sbjct: 33 MCDAVLKVEEKQFPIHKIVVSASSPYFEVLFSGGLRESYLDTVTIQGIDSETFSALLDFI 92 Query: 389 YQG 397 Y G Sbjct: 93 YTG 95 >SB_44086| Best HMM Match : BTB (HMM E-Value=1.8e-23) Length = 417 Score = 35.9 bits (79), Expect = 0.012 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 1/69 (1%) Frame = +2 Query: 197 LLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHP-IVFLKDVSHSALRD 373 +LS + V T A E + AH+ VLSV SP F+ MF + + L D AL + Sbjct: 25 VLSDVEFVVCTSAGEKISIPAHRYVLSVSSPVFEAMFHGAMAESSREISLPDCYAEALSE 84 Query: 374 LLQFMYQGE 400 +L++ Y E Sbjct: 85 MLRYAYYDE 93 >SB_18446| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 571 Score = 34.7 bits (76), Expect = 0.029 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 2/64 (3%) Frame = +2 Query: 215 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFM 388 L DV L AHK VL S +F +F M Q V LK + + DLL ++ Sbjct: 20 LCDVELIVGNNRFAAHKNVLCASSIFFNGLFSSSMRERQENTVNLKQFPVNIMEDLLTYL 79 Query: 389 YQGE 400 Y G+ Sbjct: 80 YTGK 83 >SB_6593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 34.3 bits (75), Expect = 0.038 Identities = 19/65 (29%), Positives = 37/65 (56%), Gaps = 3/65 (4%) Frame = +2 Query: 215 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSH---SALRDLLQF 385 L DVTL R + HK+VL+ SPYF+ +F + + + ++ S+ A+ +++ + Sbjct: 47 LCDVTLRHNERRIPCHKVVLAARSPYFRHLFINSESGQYVKNVELPSYFSILAVDEVINY 106 Query: 386 MYQGE 400 +Y G+ Sbjct: 107 LYSGK 111 >SB_3363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 418 Score = 34.3 bits (75), Expect = 0.038 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +2 Query: 200 LSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKD 349 L GD DV G+ AH+ +L+ S YF MF+ ++ LK+ Sbjct: 84 LESGDFADVCFVIHGQRFCAHRAILTTRSSYFASMFETKWKDKHVITLKN 133 >SB_54052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 33.9 bits (74), Expect = 0.050 Identities = 24/96 (25%), Positives = 42/96 (43%), Gaps = 5/96 (5%) Frame = +2 Query: 125 MASDEQF---SLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYF 295 M+ DE+ S+ +F ++ + L L D + G+ HK VL SP+F Sbjct: 1 MSMDEEIHFKSVIDTDFKLSILDRLNSLRKENVLCDAVIQIGGKTHPVHKNVLCAASPFF 60 Query: 296 QEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQG 397 + +F M + L+ +S +++ FMY G Sbjct: 61 RGLFTNDMQEKNQEHIELQVISGDVGEEVISFMYTG 96 >SB_13953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 33.5 bits (73), Expect = 0.066 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +2 Query: 251 LQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGE 400 + AHK VL+ SP F+ MF K+ T I L D S + ++L+F+Y E Sbjct: 41 IPAHKYVLATSSPVFEAMFFGKLAETGFTIA-LPDCSAEGMLEMLRFIYTEE 91 >SB_32554| Best HMM Match : BTB (HMM E-Value=2e-13) Length = 133 Score = 33.5 bits (73), Expect = 0.066 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = +2 Query: 251 LQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGE 400 + AHK VL+ SP F+ MF K+ T I L D + + ++L+++Y+ E Sbjct: 10 IPAHKYVLATSSPVFEAMFFGKLAETSRNIT-LPDCFYEGVLEMLRYLYRDE 60 >SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2201 Score = 33.5 bits (73), Expect = 0.066 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Frame = +2 Query: 215 LVDVTLAAEGR-LLQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLK-DVSHSALRDLLQFM 388 + D+TL + AHK+VL+ S YF+ +F + + D+S L+ +L+++ Sbjct: 28 MCDITLKTTSEDIFPAHKIVLAAKSDYFKALFTTEMAEKNCQEISLDISTRTLKAILKYV 87 Query: 389 YQGE 400 Y G+ Sbjct: 88 YCGD 91 >SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1506 Score = 33.1 bits (72), Expect = 0.087 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 3/95 (3%) Frame = +2 Query: 125 MASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEM 304 M ++ F L + +S+ L +L DVT E AH+++L+ S YF+ + Sbjct: 1 MGDNQDFQLAKIDHVELLSSQSGTLYQSRELTDVTFIVEKTKFTAHRVILAARSEYFRAL 60 Query: 305 F--KMNPTQHPI-VFLKDVSHSALRDLLQFMYQGE 400 M I + + D S A LL+++Y G+ Sbjct: 61 LFGGMREANPGIEIEVADASSIAFDALLRYIYTGK 95 >SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 467 Score = 31.1 bits (67), Expect(2) = 0.10 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 8/63 (12%) Frame = +2 Query: 197 LLSRGDLVDV--TLAAEGRLLQAHKLVLSVCSPYFQEMF----KMN--PTQHPIVFLKDV 352 +L D DV T + L AH+ +LS SP F+E+F K+N P ++ +F D+ Sbjct: 243 VLGNDDSADVKFTFSGNAPTLHAHQTILSAASPIFRELFLGSKKVNAVPRKYQAIF-SDI 301 Query: 353 SHS 361 S S Sbjct: 302 SWS 304 Score = 20.6 bits (41), Expect(2) = 0.10 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +2 Query: 347 DVSHSALRDLLQFMYQG 397 D+S + +LQF+Y G Sbjct: 329 DISCESFEKILQFLYTG 345 >SB_48929| Best HMM Match : BTB (HMM E-Value=1.4e-15) Length = 239 Score = 32.7 bits (71), Expect = 0.12 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = +2 Query: 212 DLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMY 391 D DV L E + HK +L + SP F+ MF+ PI L + + DL+ +Y Sbjct: 16 DESDVILVVEEQEFHVHKFILKMASPVFKAMFEHVKDSKPIQ-LPGKKFNQVLDLMNHIY 74 >SB_12977| Best HMM Match : BTB (HMM E-Value=1.7e-30) Length = 176 Score = 31.9 bits (69), Expect = 0.20 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 3/67 (4%) Frame = +2 Query: 209 GDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFK---MNPTQHPIVFLKDVSHSALRDLL 379 G+ DVTL + HKLVL+ S YF+ MF + +++ +V L D+ + ++ Sbjct: 30 GEGCDVTLKVTDQSFPGHKLVLAANSTYFRAMFGEGFVESSKNDVV-LHDLDPKGVNAVI 88 Query: 380 QFMYQGE 400 + Y + Sbjct: 89 SYFYNSK 95 >SB_8489| Best HMM Match : Kelch_1 (HMM E-Value=1.2e-30) Length = 619 Score = 31.5 bits (68), Expect = 0.27 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 4/68 (5%) Frame = +2 Query: 209 GDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMN----PTQHPIVFLKDVSHSALRDL 376 G+ DVTL + HKLVL+ S YF+ MF + + V L D+ + + Sbjct: 72 GEGCDVTLKVTDQSFPGHKLVLAANSTYFRAMFGLREGFVESSKNDVVLHDLDPKGVNAV 131 Query: 377 LQFMYQGE 400 + + Y + Sbjct: 132 ISYFYNSK 139 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 31.5 bits (68), Expect = 0.27 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 1/69 (1%) Frame = +2 Query: 197 LLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHP-IVFLKDVSHSALRD 373 +LS + + T A + AH+ VL+V SP F+ MF + V L D + AL + Sbjct: 443 VLSDVEFLVCTSAGVKISIPAHRYVLAVSSPVFEAMFHGAMAESSRKVSLPDCTAEALSE 502 Query: 374 LLQFMYQGE 400 +L++ Y E Sbjct: 503 MLRYAYFDE 511 >SB_40853| Best HMM Match : BTB (HMM E-Value=1.4e-17) Length = 259 Score = 31.1 bits (67), Expect = 0.35 Identities = 17/59 (28%), Positives = 28/59 (47%) Frame = +2 Query: 215 LVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMY 391 L D L E + HK LS+ SP F++MF+ Q + L ++++L +Y Sbjct: 16 LSDAVLVVEEKHFNVHKSTLSMWSPVFEKMFRERNDQE--ICLPGKKSKEIKEMLLVIY 72 >SB_37935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 30.3 bits (65), Expect = 0.61 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 288 GEHTDRTNLCACNNLPSAANVTSTRSPRDSRP 193 G H D L CN P + VTS + D+RP Sbjct: 81 GNHVDSLALSKCNATPEISEVTSVQELLDARP 112 >SB_34423| Best HMM Match : 7tm_2 (HMM E-Value=6e-07) Length = 656 Score = 30.3 bits (65), Expect = 0.61 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 288 GEHTDRTNLCACNNLPSAANVTSTRSPRDSRP 193 G H D L CN P + VTS + D+RP Sbjct: 527 GNHVDSLALSKCNATPEISEVTSVQELLDARP 558 >SB_53179| Best HMM Match : BTB (HMM E-Value=3.3e-21) Length = 604 Score = 29.1 bits (62), Expect = 1.4 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +2 Query: 197 LLSRGDLVDVTLAAEGRL--LQAHKLVLSVCSPYFQEMFKMNPTQH 328 +L R DV+ L LQAH+ VLS+ S +F++ F+ H Sbjct: 303 MLDRSTCYDVSFRFGSNLPLLQAHRFVLSIGSEWFRDFFENQDHLH 348 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 29.1 bits (62), Expect = 1.4 Identities = 14/64 (21%), Positives = 33/64 (51%) Frame = +2 Query: 203 SRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQ 382 ++ L ++ L+ + R+ Q + +C+P F ++ M+P + + L ++ D ++ Sbjct: 512 AKDGLPEMKLSCKSRIFQCSRGAGVICTPPFFDLNIMSPMRVNLEVLSTSKNAKCSDPVE 571 Query: 383 FMYQ 394 F YQ Sbjct: 572 FTYQ 575 >SB_9607| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 29.1 bits (62), Expect = 1.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +2 Query: 173 NMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF 307 N + H D D+ L E + HK++L + SP F+ MF Sbjct: 13 NETEDSHPFSKPWDDSDIILEVEEQEFYVHKMILKMASPVFKAMF 57 >SB_30894| Best HMM Match : BTB (HMM E-Value=3.1e-14) Length = 159 Score = 28.7 bits (61), Expect = 1.9 Identities = 16/63 (25%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = +2 Query: 215 LVDVTLAAEGRLLQAHKLVLSVCSPYFQE-MFKMNPTQHPIVFLK-DVSHSALRDLLQFM 388 L DV + + +AH +++S+ S YF++ + + ++ + LK ++ L ++L F+ Sbjct: 43 LCDVEVIVSDGVSKAHGVIISIGSEYFRDRLTAIACRENKRIELKYKITKGTLENVLDFL 102 Query: 389 YQG 397 Y G Sbjct: 103 YSG 105 >SB_27263| Best HMM Match : Kelch_1 (HMM E-Value=2.10055e-42) Length = 559 Score = 28.7 bits (61), Expect = 1.9 Identities = 16/63 (25%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = +2 Query: 215 LVDVTLAAEGRLLQAHKLVLSVCSPYFQE-MFKMNPTQHPIVFLK-DVSHSALRDLLQFM 388 L DV + + +AH +++S+ S YF++ + + ++ + LK ++ L ++L F+ Sbjct: 55 LCDVEVIVSDGVSKAHGVIISIGSEYFRDRLTAIACRENKRIELKYKITKGTLENVLDFL 114 Query: 389 YQG 397 Y G Sbjct: 115 YSG 117 >SB_29786| Best HMM Match : I-set (HMM E-Value=0) Length = 6300 Score = 28.3 bits (60), Expect = 2.5 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +2 Query: 251 LQAHKLVLSVCSPYFQEMFKMN-PTQHPIVFLKDVSHSALRDLLQFMYQGE 400 + HKL+L++ SP F MF + Q + + D + +LL++ Y E Sbjct: 2776 IPGHKLILAISSPVFYAMFYGSMAEQKAEITVADSDADSFMELLRYAYFDE 2826 >SB_40708| Best HMM Match : SRCR (HMM E-Value=0) Length = 1976 Score = 28.3 bits (60), Expect = 2.5 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -3 Query: 270 TNLCA-CNNLPSAANVTSTRSPRDSRP*KPADIFAWKLFQHSENCSSD 130 T++C C N P+ N +S +PR + + D A L++ S C SD Sbjct: 299 TSVCVTCANGPNGRNCSSCVAPRAPKDGECMDTCAPDLYEKSGKCVSD 346 >SB_6010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 28.3 bits (60), Expect = 2.5 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +1 Query: 67 PTGIISTKLRIGSTSSRRYHGVGRTIFTMLEQFPRKYVSRLSWPAVAWRSR 219 P ++ST++ G + R YH + + E F ++ ++R S V R Sbjct: 108 PQSLVSTQILSGKLNERSYHQTMHQLLFVEEVFMKQQIARFSMERVTLLGR 158 >SB_39167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 960 Score = 27.9 bits (59), Expect = 3.3 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = -3 Query: 384 NCNKSLSAE*LTSFKNTIGCCVGFILNIS*K*GEHTDRTNLCACNNLPSAANVTS 220 +CN + S TS+ N C N + + T N +CN+ S N TS Sbjct: 419 SCNGATSYNSATSYNNATSCNDATSYNNATSCNDATSYNNATSCNDATSYNNATS 473 >SB_45209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 995 Score = 27.9 bits (59), Expect = 3.3 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 125 MASDEQFSLCWNNFHANMSAGFHGL 199 M S E WN F N++AG+H L Sbjct: 203 MMSYEGMQFDWNTFSVNLTAGYHQL 227 >SB_26166| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 612 Score = 27.9 bits (59), Expect = 3.3 Identities = 20/73 (27%), Positives = 32/73 (43%) Frame = +2 Query: 113 VVAIMASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPY 292 +VA +A D FS + F+ + GLL GDL G + A V++ + Sbjct: 487 LVATVARDAPFSGLYLMFYTQIKRRAKGLLQVGDLTSGQNFICGIMAGAMASVVTQPADV 546 Query: 293 FQEMFKMNPTQHP 331 + +MNP +P Sbjct: 547 VKTRLQMNPYMYP 559 >SB_56853| Best HMM Match : BTB (HMM E-Value=1.1e-16) Length = 605 Score = 27.5 bits (58), Expect = 4.3 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +2 Query: 251 LQAHKLVLSVCSPYFQEMF-KMNPTQHPIVFLKDVSHSALRDLLQFMY 391 + AHK +L V SP F MF T V L D L + L+++Y Sbjct: 47 IPAHKYILGVSSPVFFAMFYGQMSTSISKVELPDCDSVGLIEFLRYLY 94 >SB_58957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 626 Score = 27.1 bits (57), Expect = 5.7 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Frame = +2 Query: 200 LSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRD 373 L++ L D+T +G + AH++VL S M K ++ L DV + Sbjct: 65 LNKALLSDITFVVKGVSVPAHRVVLITRSAVMAAMLDGKFRENDLAMIELPDVPLAPFLI 124 Query: 374 LLQFMY 391 LL+++Y Sbjct: 125 LLEYIY 130 >SB_51788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 27.1 bits (57), Expect = 5.7 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Frame = +2 Query: 200 LSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRD 373 L++ L D+T +G + AH++VL S M K ++ L DV + Sbjct: 287 LNKALLSDITFVVKGVSVPAHRVVLITRSAVMAAMLDGKFRENDLAMIELPDVPLAPFLI 346 Query: 374 LLQFMY 391 LL+++Y Sbjct: 347 LLEYIY 352 >SB_25029| Best HMM Match : Collagen (HMM E-Value=0.38) Length = 388 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/38 (28%), Positives = 24/38 (63%) Frame = +2 Query: 236 AEGRLLQAHKLVLSVCSPYFQEMFKMNPTQHPIVFLKD 349 A+ ++ + K+++ +CSP + +M +M P + P FL + Sbjct: 288 AQQQISTSSKIIV-LCSPKYLKMCQMRPKEDPKAFLTE 324 >SB_2411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 660 Score = 26.2 bits (55), Expect = 10.0 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 161 NFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHK 265 N H + + G +LS+ D D TLA L++ H+ Sbjct: 240 NIHESWTNGKDAVLSKDDYSDATLADINALMKKHE 274 >SB_48717| Best HMM Match : DUF963 (HMM E-Value=3.2e-05) Length = 477 Score = 26.2 bits (55), Expect = 10.0 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +3 Query: 99 RFHVESSLSWRRTNNFHYAGTISTQICQQAFMAC 200 +FH+ S++ R FH +I+ C Q+++ C Sbjct: 177 QFHITGSMTMTRCTQFHIIDSITR--CTQSYIIC 208 >SB_13923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 505 Score = 26.2 bits (55), Expect = 10.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 Query: 251 LQAHKLVLSVCSPYFQEMF 307 + AHK ++S+ SP F MF Sbjct: 69 IPAHKYIMSISSPVFSSMF 87 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,759,979 Number of Sequences: 59808 Number of extensions: 250180 Number of successful extensions: 686 Number of sequences better than 10.0: 68 Number of HSP's better than 10.0 without gapping: 660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 684 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 715479706 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -