BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0634 (544 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_1049 + 8275837-8275859,8276428-8276503,8276545-8276634,827... 30 1.4 01_06_1120 - 34645676-34645768,34645880-34645966,34646443-346465... 29 2.4 05_03_0557 - 15441039-15442730 29 3.2 04_04_1191 + 31599067-31600194 29 3.2 10_08_0949 - 21759821-21759833,21759985-21760301,21760650-217607... 28 4.2 07_01_0461 + 3492302-3492413,3492868-3492964,3493053-3493131,349... 28 4.2 05_05_0174 - 22960732-22960815,22960907-22961419,22961576-229620... 28 4.2 10_01_0156 + 1771224-1772099 27 7.3 06_01_1087 + 8901950-8902102,8902960-8903996,8904438-8904586,890... 27 7.3 03_02_0291 + 7148768-7148853,7148966-7149170,7149823-7150238,715... 27 7.3 09_04_0686 + 19457832-19457870,19458021-19458107,19459311-194593... 27 9.7 09_04_0291 + 16433097-16433942,16434708-16434851,16435226-164353... 27 9.7 05_07_0105 - 27716126-27716218,27716548-27716658,27716764-277168... 27 9.7 >01_01_1049 + 8275837-8275859,8276428-8276503,8276545-8276634, 8276721-8276836,8276918-8277017,8277808-8277879, 8277954-8278001,8278093-8278170,8278272-8278391, 8278496-8278601,8279574-8279737,8280403-8280537, 8280766-8280896,8282016-8282094,8282284-8282373 Length = 475 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -2 Query: 525 LDGLHDPVDDLVLDTGILTLGVLSDRDHVNVV 430 L G+ PVDDL D ++ G++ D+D N+V Sbjct: 47 LKGMGFPVDDLEFDPDLVIRGLIMDKDKGNLV 78 >01_06_1120 - 34645676-34645768,34645880-34645966,34646443-34646508, 34647126-34647215,34647317-34647397,34647598-34647675, 34647788-34647878,34647969-34648110,34648479-34648590 Length = 279 Score = 29.1 bits (62), Expect = 2.4 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = -2 Query: 252 EFAIWTPNSCYIHFLPFDRYFSCFEDFLNGDRDLGPNTMSRDERNLAHASAVLSSAGSGR 73 +FA+ TP S + LP ++ SC G+ + P T + + +L H V+ GR Sbjct: 64 KFALPTPTS--VLGLPIGQHISCRGQDATGEEVIKPYTPTTLDSDLGHFELVIKMYPQGR 121 Query: 72 W-HNFPDYSCSHFKNFR 25 H+F + + + + Sbjct: 122 MSHHFREMKVGDYMSVK 138 >05_03_0557 - 15441039-15442730 Length = 563 Score = 28.7 bits (61), Expect = 3.2 Identities = 25/100 (25%), Positives = 44/100 (44%) Frame = -3 Query: 443 TSTLSYSVLIPSKLLQGLTLAYKSNSFLRAKLSDL*PLPTGVIRGPFKPILLAFTESIAF 264 + TL Y + + L+GL + S LR+KL+ P P + + LAF Sbjct: 155 SGTLPYRTALAAVFLEGLIFLFISLVGLRSKLAKFIPKPVRISSSAGIGLFLAFI----- 209 Query: 263 WGIPNLPSGPLTAVTSTSSHSIGTLAASKIF*TATVISGP 144 G+ + L +S++ ++G AS+ A V++ P Sbjct: 210 -GLQSSEGVGLVGFSSSTLVTLGACPASQRASVAPVVTFP 248 >04_04_1191 + 31599067-31600194 Length = 375 Score = 28.7 bits (61), Expect = 3.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 293 LLAFTESIAFWGIPNLPSGPLTAVTSTS 210 LL E + FWG+PNL S P + TS Sbjct: 290 LLTSLERLNFWGLPNLLSLPANLASLTS 317 >10_08_0949 - 21759821-21759833,21759985-21760301,21760650-21760728, 21760816-21760912,21761305-21761410 Length = 203 Score = 28.3 bits (60), Expect = 4.2 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -2 Query: 270 RFLGDTEFAIWTPNSCYIHFLPFDRYF 190 RFL + EF N YIH+L +RYF Sbjct: 17 RFLLELEFIQCLANPTYIHYLAQNRYF 43 >07_01_0461 + 3492302-3492413,3492868-3492964,3493053-3493131, 3493484-3493794,3494219-3494231 Length = 203 Score = 28.3 bits (60), Expect = 4.2 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -2 Query: 270 RFLGDTEFAIWTPNSCYIHFLPFDRYF 190 RFL + EF N YIH+L +RYF Sbjct: 19 RFLLELEFIQCLANPTYIHYLAQNRYF 45 >05_05_0174 - 22960732-22960815,22960907-22961419,22961576-22962058, 22964191-22964673 Length = 520 Score = 28.3 bits (60), Expect = 4.2 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = +1 Query: 283 NANKIGLKGPLMTPVGKGYRSLNLALRKEFDLYANVRPCKSLEGIKTL 426 +A +GL + P+G+G+ +L+ ++ F L + P SL G+ +L Sbjct: 337 SALNVGLGVGAILPLGRGFMNLSSSVPDRFYLGGHSSPVCSLSGLSSL 384 >10_01_0156 + 1771224-1772099 Length = 291 Score = 27.5 bits (58), Expect = 7.3 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = -2 Query: 330 TDWSHQGTLQANFIGIYRVNRFLG---DTEFAIWTPNSCYIH 214 +D + G L N Y +RF+ DT IW PN Y H Sbjct: 147 SDGGNLGLLATNHSKAYGTDRFIAVEFDTYNNIWDPNKTYDH 188 >06_01_1087 + 8901950-8902102,8902960-8903996,8904438-8904586, 8905437-8905690,8905785-8908799,8908889-8909001, 8909975-8910164,8910399-8910512,8910591-8910698, 8910941-8911073,8911206-8911408,8911626-8911826 Length = 1889 Score = 27.5 bits (58), Expect = 7.3 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = -2 Query: 201 DRYFSCFEDFLNGDRDLGPNTMSRDERNLAHASAVLSSAGSG 76 D++F CFE+ +N +LG + + ++ +A +S+ SG Sbjct: 399 DQFFECFEELMNSQTNLGNSGIWDWTCSVFNAITFVSTLASG 440 >03_02_0291 + 7148768-7148853,7148966-7149170,7149823-7150238, 7150325-7150631,7150722-7151186 Length = 492 Score = 27.5 bits (58), Expect = 7.3 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 7/48 (14%) Frame = +1 Query: 175 IFEAAKVPIEWE------EVDVTAVRGPDGKFGI-PQKAIDSVNANKI 297 I A V + WE EV++ V+ DG + + P+KA+D VN N I Sbjct: 157 IITGANVQVCWEKFARYFEVELKEVKLRDGYYVMDPEKAVDMVNENTI 204 >09_04_0686 + 19457832-19457870,19458021-19458107,19459311-19459391, 19459463-19459489,19459589-19459651,19459768-19459854, 19460290-19460415,19460827-19460960,19461037-19461109, 19461307-19461372,19461778-19461816,19461927-19462051, 19462131-19462245,19463109-19463141,19463525-19463593 Length = 387 Score = 27.1 bits (57), Expect = 9.7 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 5/55 (9%) Frame = +1 Query: 55 IRKIVPATRAGA-AQYSTGVRKVTL---IPGHGIGPEITVA-VQKIFEAAKVPIE 204 +R I P RA A R VT+ P HGIG EI ++ V++ FE P+E Sbjct: 278 LRSIRPLDRATINASVRKTNRLVTIEESFPQHGIGAEICMSVVEESFEYLDAPVE 332 >09_04_0291 + 16433097-16433942,16434708-16434851,16435226-16435390, 16435551-16435562 Length = 388 Score = 27.1 bits (57), Expect = 9.7 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 5/47 (10%) Frame = -3 Query: 473 SPSVFSLIVTT-STLSYSV----LIPSKLLQGLTLAYKSNSFLRAKL 348 +P++ S +VT+ TL Y L P+KLL+GL +YK+ L+ L Sbjct: 257 APNLLSAMVTSLETLDYYYYALPLSPTKLLKGLPSSYKNLKRLKVHL 303 >05_07_0105 - 27716126-27716218,27716548-27716658,27716764-27716815, 27716895-27717034,27717298-27717422,27717514-27717638, 27717853-27717898,27718374-27718947 Length = 421 Score = 27.1 bits (57), Expect = 9.7 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +1 Query: 409 EGIKTLYDNVDVVTIRENTEGEYSGIEHEIVDGVVQSIK 525 E ++ L + D+V N +G+ IE EI+DGVV +++ Sbjct: 255 EALQKLNKHYDIVV---NIQGDEPLIEPEIIDGVVMALQ 290 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.316 0.136 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,335,898 Number of Sequences: 37544 Number of extensions: 287022 Number of successful extensions: 935 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 912 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 935 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1210221432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -