BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0632 (740 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 22 4.5 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 6.0 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -2 Query: 301 TLPFLSQSPYLVGSGPLGPPT 239 T+P +P ++ GP PPT Sbjct: 147 TMPKYEPNPSIIDPGPALPPT 167 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.8 bits (44), Expect = 6.0 Identities = 14/43 (32%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = +3 Query: 72 EKENESVKKPESKRLSEFRKKLRETTSITDLG--EQTSNSKED 194 EKE + E K+ E K ++ I D+G E KED Sbjct: 220 EKELSDDEAEEEKKEEEGEDKDKDKPKIEDVGEDEDEDTKKED 262 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,162 Number of Sequences: 336 Number of extensions: 3231 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -