BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0632 (740 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g67490.1 68418.m08511 expressed protein 58 6e-09 At5g49670.1 68418.m06150 hypothetical protein 27 9.9 >At5g67490.1 68418.m08511 expressed protein Length = 108 Score = 58.0 bits (134), Expect = 6e-09 Identities = 21/26 (80%), Positives = 25/26 (96%) Frame = +3 Query: 234 GEVGGPKGPEPTRYGDWERKGRVSDF 311 GE+GGP+GPEPTRYGDWE++GR SDF Sbjct: 83 GEIGGPRGPEPTRYGDWEQRGRCSDF 108 >At5g49670.1 68418.m06150 hypothetical protein Length = 1184 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +3 Query: 66 PIEKENESVKKPESKRLSEFRKKLRETTSITDLGEQ 173 PI+KE+ + KKP SK++ R +R+ I D+ E+ Sbjct: 947 PIKKESSTPKKPGSKKVGRIRFGIRKL--IFDIEEE 980 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,334,940 Number of Sequences: 28952 Number of extensions: 244507 Number of successful extensions: 653 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1633819784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -