BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0629 (709 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY748836-1|AAV28184.1| 89|Anopheles gambiae cytochrome P450 pr... 23 7.1 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 23 9.4 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 23 9.4 >AY748836-1|AAV28184.1| 89|Anopheles gambiae cytochrome P450 protein. Length = 89 Score = 23.4 bits (48), Expect = 7.1 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 166 NLRYKIRNLI*KPSQFTILL 107 N+RY+ RNLI +P +LL Sbjct: 2 NIRYRERNLIKRPDFIHLLL 21 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 23.0 bits (47), Expect = 9.4 Identities = 12/48 (25%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +3 Query: 558 VLK-MKTSS*STMVLVGYLWLMQAKTQMDLNFSSQLLRHPGLDGRHGC 698 VLK +K ++++ W+M + F L HP + G C Sbjct: 150 VLKPLKVHEHRAVLMIAAAWIMSGLCSLPQAFIFHLEGHPNITGYQQC 197 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 23.0 bits (47), Expect = 9.4 Identities = 12/48 (25%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +3 Query: 558 VLK-MKTSS*STMVLVGYLWLMQAKTQMDLNFSSQLLRHPGLDGRHGC 698 VLK +K ++++ W+M + F L HP + G C Sbjct: 150 VLKPLKVHEHRAVLMIAAAWIMSGLCSLPQAFIFHLEGHPNITGYQQC 197 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 711,521 Number of Sequences: 2352 Number of extensions: 13267 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -