BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0625 (756 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 95 4e-20 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 89 2e-18 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 89 4e-18 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 89 4e-18 At3g04780.1 68416.m00515 expressed protein 89 4e-18 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 82 3e-16 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 79 4e-15 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 79 4e-15 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 75 4e-14 At2g40790.1 68415.m05032 thioredoxin family protein contains Pfa... 69 3e-12 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 69 4e-12 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 68 6e-12 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 67 1e-11 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 67 1e-11 At2g35010.1 68415.m04295 thioredoxin family protein similar to S... 64 1e-10 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 63 2e-10 At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa... 63 2e-10 At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thiore... 60 2e-09 At3g53220.1 68416.m05864 thioredoxin family protein low similari... 59 3e-09 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 59 4e-09 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 58 6e-09 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 57 1e-08 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 56 2e-08 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 56 2e-08 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 56 3e-08 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 56 3e-08 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 56 3e-08 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 52 4e-07 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 51 1e-06 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 51 1e-06 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 50 1e-06 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 50 1e-06 At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containi... 50 2e-06 At5g04260.1 68418.m00417 thioredoxin family protein low similari... 50 2e-06 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 48 9e-06 At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi... 47 1e-05 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 47 1e-05 At1g76080.1 68414.m08835 thioredoxin family protein low similari... 45 5e-05 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 44 8e-05 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 44 8e-05 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 44 8e-05 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 44 8e-05 At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containi... 43 2e-04 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 40 0.002 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 40 0.002 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 39 0.003 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 39 0.003 At3g03860.1 68416.m00398 expressed protein 39 0.004 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 38 0.005 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 38 0.010 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 37 0.013 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 37 0.013 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 36 0.029 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 36 0.038 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 36 0.038 At1g07700.3 68414.m00829 thioredoxin family protein low similari... 36 0.038 At1g07700.1 68414.m00828 thioredoxin family protein low similari... 36 0.038 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 35 0.051 At5g40370.1 68418.m04897 glutaredoxin, putative similar to gluta... 33 0.15 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 33 0.15 At5g18120.1 68418.m02127 expressed protein 33 0.27 At1g60420.1 68414.m06802 DC1 domain-containing protein contains ... 31 0.62 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 31 0.83 At4g08930.1 68417.m01470 thioredoxin-related contains weak simil... 31 1.1 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 30 1.9 At5g02370.1 68418.m00160 kinesin motor protein-related kinesin, ... 29 2.5 At4g40020.1 68417.m05666 hypothetical protein 29 4.4 At1g34780.1 68414.m04329 protein disulfide isomerase-related con... 28 5.8 At1g15740.1 68414.m01888 leucine-rich repeat family protein 28 7.7 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 95.1 bits (226), Expect = 4e-20 Identities = 45/100 (45%), Positives = 59/100 (59%), Gaps = 1/100 (1%) Frame = +3 Query: 96 QTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF-PRAVFLKVDVDRCADTASAQG 272 Q + A KL+V+DFTA+WCPPC+ IAP F L KF A+F KVDVD A G Sbjct: 20 QLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVDVDELQSVAKEFG 79 Query: 273 VSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYYGSDVA 392 V AMPTF+F + +D+L G N L+ K+ ++ G A Sbjct: 80 VEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKHTGVTTA 119 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 89.4 bits (212), Expect = 2e-18 Identities = 40/91 (43%), Positives = 54/91 (59%) Frame = +3 Query: 108 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMP 287 AN KL+V+DFTA+WCPPC+ IAP F ++ KF VF K+DVD A V AMP Sbjct: 23 ANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFTNVVFFKIDVDELQAVAQEFKVEAMP 82 Query: 288 TFIFYRNRTKIDRLEGGNTTVLENKVRQYYG 380 TF+F + IDR+ G + K+ ++ G Sbjct: 83 TFVFMKEGNIIDRVVGAAKDEINEKLMKHGG 113 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 88.6 bits (210), Expect = 4e-18 Identities = 40/93 (43%), Positives = 55/93 (59%) Frame = +3 Query: 96 QTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGV 275 Q + AN LVVVDFTA+WC PC+ IAPFF L K P +FLKVD D AS + Sbjct: 20 QLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAI 79 Query: 276 SAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQY 374 AMPTF+F + +D++ G L++ + ++ Sbjct: 80 QAMPTFMFLKEGKILDKVVGAKKDELQSTIAKH 112 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 88.6 bits (210), Expect = 4e-18 Identities = 36/96 (37%), Positives = 63/96 (65%) Frame = +3 Query: 96 QTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGV 275 +T+ A ++L+++ FTATWC PC+ ++P + L + R VFLKVD+D+ D A++ + Sbjct: 284 KTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHSRVVFLKVDIDKANDVAASWNI 343 Query: 276 SAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYYGS 383 S++PTF F R+ ++D++ G + LE K+ Q+ S Sbjct: 344 SSVPTFCFIRDGKEVDKVVGADKGSLEQKIAQHSSS 379 >At3g04780.1 68416.m00515 expressed protein Length = 176 Score = 88.6 bits (210), Expect = 4e-18 Identities = 50/124 (40%), Positives = 68/124 (54%), Gaps = 5/124 (4%) Frame = +3 Query: 387 VAEEDEDNTVAGHMDLITFITKSECECLNEADDHPLAQALTN----DRGY-LASYCDEQL 551 ++ E G +DL+ FI S ECLN++ H L AL D G L S DEQL Sbjct: 1 MSAESASQIPKGQVDLLDFIDWSGVECLNQSSSHSLPNALKQGYREDEGLNLESDADEQL 60 Query: 552 IINISFNQLVKLHSIKIKGPADKGPKSIKLFINQPRTLDFDQAAGYSSVQDLELTPSDLE 731 +I I FNQ++KLHS IKGP ++GPK++K F N+ + F + ELT +L+ Sbjct: 61 LIYIPFNQVIKLHSFAIKGPEEEGPKTVKFFSNKEH-MCFSNVNDFPPSDTAELTEENLK 119 Query: 732 GNPV 743 G PV Sbjct: 120 GKPV 123 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 82.2 bits (194), Expect = 3e-16 Identities = 38/86 (44%), Positives = 54/86 (62%) Frame = +3 Query: 108 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMP 287 A+ K+VV +F+ATWC PC+ +APFF +L K +FL VDVD +D +S+ + A P Sbjct: 41 ADRDGKIVVANFSATWCGPCKIVAPFFIELSEKHSSLMFLLVDVDELSDFSSSWDIKATP 100 Query: 288 TFIFYRNRTKIDRLEGGNTTVLENKV 365 TF F +N +I +L G N L+ KV Sbjct: 101 TFFFLKNGQQIGKLVGANKPELQKKV 126 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 78.6 bits (185), Expect = 4e-15 Identities = 37/66 (56%), Positives = 41/66 (62%) Frame = +3 Query: 108 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMP 287 AN KL+V+DFTATWCPPC+ IAP F L K VF KVDVD A V AMP Sbjct: 23 ANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLDVVFFKVDVDELNTVAEEFKVQAMP 82 Query: 288 TFIFYR 305 TFIF + Sbjct: 83 TFIFMK 88 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 78.6 bits (185), Expect = 4e-15 Identities = 33/84 (39%), Positives = 49/84 (58%) Frame = +3 Query: 123 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFY 302 KL+V+DFTA WC PC+ + P ++ +K+ AVF +VDVDR D A +P F+F Sbjct: 44 KLLVIDFTAVWCGPCKAMEPRVREIASKYSEAVFARVDVDRLMDVAGTYRAITLPAFVFV 103 Query: 303 RNRTKIDRLEGGNTTVLENKVRQY 374 + +IDR+ G L K+ Q+ Sbjct: 104 KRGEEIDRVVGAKPDELVKKIEQH 127 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 75.4 bits (177), Expect = 4e-14 Identities = 35/81 (43%), Positives = 48/81 (59%) Frame = +3 Query: 123 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFY 302 KL+VVDF+A+WC PC+ I P + KF F+K+DVD D A V+AMPTF+ Sbjct: 48 KLLVVDFSASWCGPCRMIEPAIHAMADKFNDVDFVKLDVDELPDVAKEFNVTAMPTFVLV 107 Query: 303 RNRTKIDRLEGGNTTVLENKV 365 + +I+R+ G LE KV Sbjct: 108 KRGKEIERIIGAKKDELEKKV 128 >At2g40790.1 68415.m05032 thioredoxin family protein contains Pfam profile: PF00085 thioredoxin Length = 154 Score = 68.9 bits (161), Expect = 3e-12 Identities = 28/85 (32%), Positives = 53/85 (62%) Frame = +3 Query: 108 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMP 287 AN+ K++VV+F A+WC P + I P +++L + + +F+ +DV+ A+ + V A P Sbjct: 58 ANSHGKILVVNFKASWCLPSKTILPIYQELASTYTSMIFVTIDVEELAEFSHEWNVDATP 117 Query: 288 TFIFYRNRTKIDRLEGGNTTVLENK 362 T +F ++ ++D+L GG+ L+ K Sbjct: 118 TVVFLKDGRQMDKLVGGDAAELQKK 142 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 68.5 bits (160), Expect = 4e-12 Identities = 31/90 (34%), Positives = 52/90 (57%) Frame = +3 Query: 129 VVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFYRN 308 VV+ F A+WC +++ F L FPRA F +V+ + + + A V+A+P F+F+++ Sbjct: 24 VVLHFWASWCDASKQMDQVFSHLATDFPRAHFFRVEAEEHPEISEAYSVAAVPYFVFFKD 83 Query: 309 RTKIDRLEGGNTTVLENKVRQYYGSDVAEE 398 +D LEG + + L NKV + GS + E Sbjct: 84 GKTVDTLEGADPSSLANKVGKVAGSSTSAE 113 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 68.1 bits (159), Expect = 6e-12 Identities = 29/84 (34%), Positives = 47/84 (55%) Frame = +3 Query: 123 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFY 302 KL+V++FTA WC PC+ + P E+L AK+ F+K+DVD +S +P +F Sbjct: 60 KLLVIEFTAKWCGPCKTLEPKLEELAAKYTDVEFVKIDVDVLMSVWMEFNLSTLPAIVFM 119 Query: 303 RNRTKIDRLEGGNTTVLENKVRQY 374 + ++D + G LE K+ +Y Sbjct: 120 KRGREVDMVVGVKVDELERKLNKY 143 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 67.3 bits (157), Expect = 1e-11 Identities = 32/79 (40%), Positives = 46/79 (58%) Frame = +3 Query: 129 VVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFYRN 308 +V FTA WC P + FFE+L + A+FL VDVD + AS V AMPTF+F ++ Sbjct: 27 IVAHFTALWCIPSVFMNSFFEELAFNYKDALFLIVDVDEVKEVASQLEVKAMPTFLFLKD 86 Query: 309 RTKIDRLEGGNTTVLENKV 365 +D+L G N ++ +V Sbjct: 87 GNAMDKLVGANPDEIKKRV 105 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 66.9 bits (156), Expect = 1e-11 Identities = 30/85 (35%), Positives = 50/85 (58%) Frame = +3 Query: 108 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMP 287 AN G K + A WC PC++I P F L +++P +F+ VDV+ A+ ++ V A P Sbjct: 6 ANTGPKERSI--RAPWCVPCKKIEPVFRDLASRYPSMIFVTVDVEELAEFSNEWNVEATP 63 Query: 288 TFIFYRNRTKIDRLEGGNTTVLENK 362 T +F ++ ++D+L G T+ L+ K Sbjct: 64 TVVFLKDGRQMDKLVGAETSELQKK 88 >At2g35010.1 68415.m04295 thioredoxin family protein similar to SP|Q42443 Thioredoxin H-type (TRX-H) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 194 Score = 63.7 bits (148), Expect = 1e-10 Identities = 33/106 (31%), Positives = 58/106 (54%), Gaps = 4/106 (3%) Frame = +3 Query: 72 VIQNDAHFQTEMANA--GTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDR 245 +++++ F M+ A G+ V FTA WC PC+ I+P +L ++P KVD+D Sbjct: 88 LVKSEEEFINAMSKAQDGSLPSVFYFTAAWCGPCRFISPVIVELSKQYPDVTTYKVDIDE 147 Query: 246 --CADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYY 377 ++T S ++A+PT F++ +K + G + T L+N + Q Y Sbjct: 148 GGISNTISKLNITAVPTLHFFKGGSKKGEVVGADVTKLKNLMEQLY 193 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 63.3 bits (147), Expect = 2e-10 Identities = 28/85 (32%), Positives = 49/85 (57%) Frame = +3 Query: 129 VVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFYRN 308 +V+ F A+WC +++ F L FPRA F +V+ + + + A V+ +P F+F+++ Sbjct: 24 LVLHFWASWCDASKQMDQVFSHLATDFPRAHFFRVEAEEHPEISEAYSVALVPYFVFFKD 83 Query: 309 RTKIDRLEGGNTTVLENKVRQYYGS 383 +D LEG + + L NKV + GS Sbjct: 84 GKTVDTLEGADPSSLANKVGKVAGS 108 >At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam profiles PF00085: Thioredoxin, PF00515: TPR Domain; similar to tetratricopeptide repeat protein 2 (GI:7248701) [Drosophila melanogaster]; similar to DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615) [Homo sapiens] Length = 699 Score = 63.3 bits (147), Expect = 2e-10 Identities = 28/83 (33%), Positives = 47/83 (56%) Frame = +3 Query: 132 VVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFYRNR 311 V+ F+ C++I+PF + L ++P FLKVD+D+C +A+ V +PT Y+N Sbjct: 617 VIHFSTASDHQCKQISPFVDSLCTRYPSIHFLKVDIDKCPSIGNAENVRVVPTVKIYKNG 676 Query: 312 TKIDRLEGGNTTVLENKVRQYYG 380 +++ + + VLE VR Y G Sbjct: 677 SRVKEIVCPSKEVLEYSVRHYSG 699 >At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thioredoxin 2 from Saccharomyces cerevisiae GI:173050, 3'-end of protein contains similarity to thioredoxins; contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin o (TRXO2) GI:15081458 Length = 159 Score = 60.1 bits (139), Expect = 2e-09 Identities = 33/106 (31%), Positives = 56/106 (52%), Gaps = 4/106 (3%) Frame = +3 Query: 72 VIQNDAHFQTEMANA--GTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDR 245 V++++A F + ++ A G+ V FTA WC PC+ I+P +L K+P KVD+D Sbjct: 53 VLKSEAEFNSALSKARDGSLPSVFYFTAAWCGPCRLISPVILELSNKYPDVTTYKVDIDE 112 Query: 246 --CADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYY 377 ++ VSA+PT F++ K + G + L++ + Q Y Sbjct: 113 GGLSNAIGKLNVSAVPTLQFFKGGVKKAEIVGVDVVRLKSVMEQLY 158 >At3g53220.1 68416.m05864 thioredoxin family protein low similarity to SP|P29451 Thioredoxin [Rhesus macaque] {Macaca mulatta}; contains Pfam profile: PF00085 Thioredoxin Length = 126 Score = 59.3 bits (137), Expect = 3e-09 Identities = 30/104 (28%), Positives = 52/104 (50%), Gaps = 2/104 (1%) Frame = +3 Query: 60 GLATVIQNDAHFQTEMAN--AGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKV 233 G + ND F T + + + V+++ A+WC C +I P F +L F + F+ Sbjct: 21 GNVKIAPNDQSFLTILDDIKSSKSPAVINYGASWCGVCSQILPAFRKLSNSFSKLKFVYA 80 Query: 234 DVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKV 365 D+D C +T + + PTF FYR+ K+D + G L +++ Sbjct: 81 DIDECPET--TRHIRYTPTFQFYRDGEKVDEMFGAGEQRLHDRL 122 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 58.8 bits (136), Expect = 4e-09 Identities = 31/95 (32%), Positives = 50/95 (52%), Gaps = 1/95 (1%) Frame = +3 Query: 54 TMGLATVIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKV 233 T+G T + D + A AG K+VV+D WC PC+ IAP +++L K+ VFLK+ Sbjct: 76 TVGQVTEVDKDTFWPIVKA-AGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQDMVFLKL 134 Query: 234 DVDR-CADTASAQGVSAMPTFIFYRNRTKIDRLEG 335 D ++ A G+ +PTF ++ + + G Sbjct: 135 DCNQDNKPLAKELGIRVVPTFKILKDNKVVKEVTG 169 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 58.0 bits (134), Expect = 6e-09 Identities = 28/86 (32%), Positives = 49/86 (56%), Gaps = 1/86 (1%) Frame = +3 Query: 81 NDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFP-RAVFLKVDVDRCADT 257 +D+ +QT++ + V+V+F A WC PC+ I P +QL F + F K++ D +T Sbjct: 92 SDSEWQTKVLESDVP-VLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDESPNT 150 Query: 258 ASAQGVSAMPTFIFYRNRTKIDRLEG 335 A+ G+ ++PT I ++ K D + G Sbjct: 151 ANRYGIRSVPTVIIFKGGEKKDSIIG 176 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 56.8 bits (131), Expect = 1e-08 Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 1/85 (1%) Frame = +3 Query: 93 FQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAV-FLKVDVDRCADTASAQ 269 F+ + N+ K V+VD+ ATWC PCQ + P ++ + +K+D ++ A+ Sbjct: 73 FEDLLVNSD-KPVLVDYYATWCGPCQFMVPILNEVSETLKDKIQVVKIDTEKYPSIANKY 131 Query: 270 GVSAMPTFIFYRNRTKIDRLEGGNT 344 + A+PTFI +++ DR EG T Sbjct: 132 KIEALPTFILFKDGEPCDRFEGALT 156 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 56.4 bits (130), Expect = 2e-08 Identities = 26/77 (33%), Positives = 40/77 (51%) Frame = +3 Query: 75 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCAD 254 I + F + ++ AG +LV+V+F TWC C+ + P + + P VFLKV+ D Sbjct: 108 IHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIVFLKVNFDENKP 167 Query: 255 TASAQGVSAMPTFIFYR 305 + V +P F FYR Sbjct: 168 MCKSLNVRVLPFFHFYR 184 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 56.4 bits (130), Expect = 2e-08 Identities = 26/77 (33%), Positives = 40/77 (51%) Frame = +3 Query: 75 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCAD 254 I + F + ++ AG +LV+V+F TWC C+ + P + + P VFLKV+ D Sbjct: 108 IHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIVFLKVNFDENKP 167 Query: 255 TASAQGVSAMPTFIFYR 305 + V +P F FYR Sbjct: 168 MCKSLNVRVLPFFHFYR 184 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 56.0 bits (129), Expect = 3e-08 Identities = 31/95 (32%), Positives = 48/95 (50%), Gaps = 1/95 (1%) Frame = +3 Query: 54 TMGLATVIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKV 233 ++G T + D + A AG KLVV+D WC PC+ IAP ++ L K+ VFLK+ Sbjct: 66 SVGQVTEVDKDTFWPIVKA-AGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDDVVFLKL 124 Query: 234 DVD-RCADTASAQGVSAMPTFIFYRNRTKIDRLEG 335 D + A G+ +PTF ++ + + G Sbjct: 125 DCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTG 159 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 56.0 bits (129), Expect = 3e-08 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 1/72 (1%) Frame = +3 Query: 123 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAV-FLKVDVDRCADTASAQGVSAMPTFIF 299 K V+VDF ATWC PCQ + P ++ + +K+D ++ A+ + A+PTFI Sbjct: 77 KPVLVDFYATWCGPCQLMVPILNEVSETLKDIIAVVKIDTEKYPSLANKYQIEALPTFIL 136 Query: 300 YRNRTKIDRLEG 335 +++ DR EG Sbjct: 137 FKDGKLWDRFEG 148 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 55.6 bits (128), Expect = 3e-08 Identities = 26/77 (33%), Positives = 39/77 (50%) Frame = +3 Query: 75 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCAD 254 I + F + +AG +LV+VDF TWC C+ + P + + P +FLKV+ D Sbjct: 98 ITSAEQFLNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTAKEHPNILFLKVNFDENKS 157 Query: 255 TASAQGVSAMPTFIFYR 305 + V +P F FYR Sbjct: 158 LCKSLNVKVLPYFHFYR 174 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/77 (35%), Positives = 38/77 (49%) Frame = +3 Query: 75 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCAD 254 IQ+ H + NAG +LVV+DF + C C+ + P QL P +FLKV+ + Sbjct: 90 IQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQLAETNPNVMFLKVNQEELRT 149 Query: 255 TASAQGVSAMPTFIFYR 305 V +P F FYR Sbjct: 150 MCHGLNVHVLPFFKFYR 166 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 50.8 bits (116), Expect = 1e-06 Identities = 34/111 (30%), Positives = 55/111 (49%), Gaps = 5/111 (4%) Frame = +3 Query: 72 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRA---VFLKVDVD 242 V+ D F+ E+ K +V+F A WC C+++AP +E+L A F +A + KVD D Sbjct: 26 VVLTDDSFEKEVGK--DKGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCD 83 Query: 243 RCADTASAQGVSAMPTFIFY-RNRTKIDRLEG-GNTTVLENKVRQYYGSDV 389 + GVS PT ++ + + + EG N L V + G++V Sbjct: 84 EQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGGTNV 134 Score = 41.1 bits (92), Expect = 8e-04 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Frame = +3 Query: 123 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPR---AVFLKVDVDRCADTASAQGVSAMPTF 293 K V+V+F A WC C+ +AP +E++ F + V +D D GVS PT Sbjct: 160 KDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPTL 219 Query: 294 IFYRNRTK 317 F+ K Sbjct: 220 KFFPKDNK 227 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 50.8 bits (116), Expect = 1e-06 Identities = 34/111 (30%), Positives = 55/111 (49%), Gaps = 5/111 (4%) Frame = +3 Query: 72 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRA---VFLKVDVD 242 V+ D F+ E+ K +V+F A WC C+++AP +E+L A F +A + KVD D Sbjct: 26 VVLTDDSFEKEVGK--DKGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCD 83 Query: 243 RCADTASAQGVSAMPTFIFY-RNRTKIDRLEG-GNTTVLENKVRQYYGSDV 389 + GVS PT ++ + + + EG N L V + G++V Sbjct: 84 EQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGGTNV 134 Score = 41.1 bits (92), Expect = 8e-04 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Frame = +3 Query: 123 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPR---AVFLKVDVDRCADTASAQGVSAMPTF 293 K V+V+F A WC C+ +AP +E++ F + V +D D GVS PT Sbjct: 160 KDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPTL 219 Query: 294 IFYRNRTK 317 F+ K Sbjct: 220 KFFPKDNK 227 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 50.4 bits (115), Expect = 1e-06 Identities = 28/88 (31%), Positives = 44/88 (50%), Gaps = 1/88 (1%) Frame = +3 Query: 75 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAV-FLKVDVDRCA 251 + ND+ + + + A T VVVDF A WC PC+ I P L + + F K++ D Sbjct: 84 VVNDSTWDSLVLKA-TGPVVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESP 142 Query: 252 DTASAQGVSAMPTFIFYRNRTKIDRLEG 335 +T GV ++PT + + K D + G Sbjct: 143 NTPGQYGVRSIPTIMIFVGGEKKDTIIG 170 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 50.4 bits (115), Expect = 1e-06 Identities = 28/88 (31%), Positives = 44/88 (50%), Gaps = 1/88 (1%) Frame = +3 Query: 75 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFP-RAVFLKVDVDRCA 251 + ND+ + + + A V VDF A WC PC+ I P +L K+ + F K++ D Sbjct: 78 VVNDSTWDSLVLKADEP-VFVDFWAPWCGPCKMIDPIVNELAQKYAGQFKFYKLNTDESP 136 Query: 252 DTASAQGVSAMPTFIFYRNRTKIDRLEG 335 T GV ++PT + + N K D + G Sbjct: 137 ATPGQYGVRSIPTIMIFVNGEKKDTIIG 164 >At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q99615 DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 721 Score = 50.0 bits (114), Expect = 2e-06 Identities = 22/72 (30%), Positives = 39/72 (54%) Frame = +3 Query: 159 PPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGG 338 P C+ I+ F + L ++P FLKV++ +C + +A+ V +PTF Y+ ++ + Sbjct: 648 PQCKEISTFVDALCVRYPSLHFLKVEIVKCPEVGNAERVRVVPTFKIYKLGIRMKEIVCP 707 Query: 339 NTTVLENKVRQY 374 + LE VR Y Sbjct: 708 SKEALEKTVRHY 719 >At5g04260.1 68418.m00417 thioredoxin family protein low similarity to SP|P29429 Thioredoxin. [Aspergillus nidulans] {Emericella nidulans}; contains Pfam profile: PF00085 Thioredoxin Length = 192 Score = 49.6 bits (113), Expect = 2e-06 Identities = 36/109 (33%), Positives = 55/109 (50%), Gaps = 5/109 (4%) Frame = +3 Query: 75 IQNDAHFQTEMANAGT--KLVVVDFTATWCPPCQRIAPFFEQLPAKF-PRAVFLKVDVDR 245 I ++HF M +A + VV+ + A WC C + P E+L A+F PR F VDV+ Sbjct: 81 ICGESHFDQVMEDAQKLGESVVIVWMAAWCRKCIYLKPKLEKLAAEFYPRLRFYHVDVNA 140 Query: 246 CA-DTASAQGVSAMPTFIFYRNRTKIDRLEGGNTT-VLENKVRQYYGSD 386 S GV+ MPT +R+ K + GG+ + N+VR+ +D Sbjct: 141 VPYRLVSRAGVTKMPTIQLWRDGQKQAEVIGGHKAHFVVNEVREMIEND 189 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 47.6 bits (108), Expect = 9e-06 Identities = 25/67 (37%), Positives = 34/67 (50%) Frame = +3 Query: 105 MANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAM 284 + NAG KLVVVDF + C C+ + P Q P FL+V+ + + GV + Sbjct: 112 LTNAGDKLVVVDFFSPGCGGCKALHPKICQFAEMNPDVQFLQVNYEEHKSMCYSLGVHVL 171 Query: 285 PTFIFYR 305 P F FYR Sbjct: 172 PFFRFYR 178 >At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 691 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/70 (28%), Positives = 36/70 (51%) Frame = +3 Query: 165 CQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNT 344 C+ I+PF L ++P F VDV+ A A+ + +PTF Y+N K+ + + Sbjct: 620 CEEISPFINTLCLRYPLVHFFMVDVEESMALAKAESIRKVPTFKMYKNGDKVKEMVCPSH 679 Query: 345 TVLENKVRQY 374 LE+ ++ + Sbjct: 680 QFLEDSIKHF 689 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 47.2 bits (107), Expect = 1e-05 Identities = 23/67 (34%), Positives = 35/67 (52%) Frame = +3 Query: 105 MANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAM 284 + NAG KLVVVDF + C C+ + P ++ K P FL+V+ + + + + Sbjct: 108 LRNAGDKLVVVDFFSPSCGGCKALHPKICKIAEKNPEVEFLQVNYEEHRSLCQSLNIHVL 167 Query: 285 PTFIFYR 305 P F FYR Sbjct: 168 PFFRFYR 174 >At1g76080.1 68414.m08835 thioredoxin family protein low similarity to thioredoxin (TRX) [Fasciola hepatica] GI:6687568; contains Pfam profile PF00085: Thioredoxin Length = 302 Score = 45.2 bits (102), Expect = 5e-05 Identities = 31/107 (28%), Positives = 47/107 (43%), Gaps = 3/107 (2%) Frame = +3 Query: 75 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKV---DVDR 245 I + F + NA +KLVV +F + +I PF +L VFL V + D+ Sbjct: 78 IHSGEEFDVALKNAKSKLVVAEFATSKSDQSNKIYPFMVELSRTCNDVVFLLVMGDESDK 137 Query: 246 CADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYYGSD 386 + + + +P F FY++ KI EG L V YYG + Sbjct: 138 TRELCRREKIEKVPHFSFYKSMEKIHEEEGIEPDQLMGDV-LYYGDN 183 Score = 37.5 bits (83), Expect = 0.010 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 4/92 (4%) Frame = +3 Query: 117 GTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPR-AVFLKV---DVDRCADTASAQGVSAM 284 G KL+V+D C PC ++ P +L VF ++ + D C + V + Sbjct: 206 GGKLIVLDVGLKHCGPCVKVYPTVLKLSRSMSETVVFARMNGDENDSCMEFLKDMNVIEV 265 Query: 285 PTFIFYRNRTKIDRLEGGNTTVLENKVRQYYG 380 PTF+F R+ R G L ++ +Y G Sbjct: 266 PTFLFIRDGEIRGRYVGSGKGELIGEILRYSG 297 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 44.4 bits (100), Expect = 8e-05 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +3 Query: 129 VVVDFTATWCPPCQRIAPFFEQLPAKF-PRAVFLKVDVDRCADTASAQGVSAMPTFIF 299 ++VDF ATWC PC +A E L ++ A+ +KVD D + A V +PT F Sbjct: 97 LIVDFYATWCGPCILMAQELEMLAVEYESNAIIVKVDTDDEYEFARDMQVRGLPTLFF 154 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 44.4 bits (100), Expect = 8e-05 Identities = 24/93 (25%), Positives = 47/93 (50%), Gaps = 1/93 (1%) Frame = +3 Query: 99 TEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAV-FLKVDVDRCADTASAQGV 275 TE+ N+ T V+V FTA WC PC+ + P ++ +++ F V+ D + Sbjct: 221 TEL-NSQTPHVMVMFTARWCGPCRDMIPILNKMDSEYKNEFKFYTVNFDTEIRFTERFDI 279 Query: 276 SAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQY 374 S +PT + ++ ++ ++ G + L V++Y Sbjct: 280 SYLPTTLVFKGGEQMAKVTGADPKKLRELVKKY 312 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 44.4 bits (100), Expect = 8e-05 Identities = 25/85 (29%), Positives = 45/85 (52%), Gaps = 3/85 (3%) Frame = +3 Query: 129 VVVDFTATWCPPCQRIAPFFEQLPAKF-PRAVFLKVDVDRCADTASAQGVSAMPTFIFYR 305 V+V+F ATWC PC+ I P E L ++ + +K+D D + V +P FI ++ Sbjct: 90 VLVEFVATWCGPCKLIYPAMEALSQEYGDKLTIVKIDHDANPKLIAEFKVYGLPHFILFK 149 Query: 306 NRTKI--DRLEGGNTTVLENKVRQY 374 + ++ R EG + + K+++Y Sbjct: 150 DGKEVPGSRREG---AITKAKLKEY 171 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 44.4 bits (100), Expect = 8e-05 Identities = 29/121 (23%), Positives = 60/121 (49%), Gaps = 5/121 (4%) Frame = +3 Query: 69 TVIQ-NDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQ---LPAKFPRAVFL-KV 233 TV++ D++F + ++ + VDF A WC C+R+ P + + AK + + + K+ Sbjct: 33 TVLELTDSNFDSAISTFDC--IFVDFYAPWCGHCKRLNPELDAAAPILAKLKQPIVIAKL 90 Query: 234 DVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYYGSDVAEEDEDNT 413 + D+ + A + A PT + Y + ++ +L ++++ DVA + D+T Sbjct: 91 NADKYSRLARKIEIDAFPTLMLYNHGVPMEYYGPRKADLLVRYLKKFVAPDVAVLESDST 150 Query: 414 V 416 V Sbjct: 151 V 151 >At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 682 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/69 (28%), Positives = 35/69 (50%) Frame = +3 Query: 168 QRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTT 347 + I+PF L ++P F KVDV+ A A+ + +PTF Y+ K+ + + Sbjct: 612 EAISPFVNTLCLRYPLVHFFKVDVEESLALAKAESIKKIPTFKIYKKGEKVKEMVCPSHQ 671 Query: 348 VLENKVRQY 374 +LE+ V + Sbjct: 672 LLEDSVTHF 680 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 3/77 (3%) Frame = +3 Query: 123 KLVVVDFTATWCPPCQRIAPFFEQLPAKF---PRAVFLKVDVDRCADTASAQGVSAMPTF 293 K V+++F A WC CQ++AP +++ F P + K+D + V PT Sbjct: 391 KNVLIEFYAPWCGHCQKLAPILDEVALSFQNDPSVIIAKLDATANDIPSDTFDVKGFPTI 450 Query: 294 IFYRNRTKIDRLEGGNT 344 F + EG T Sbjct: 451 YFRSASGNVVVYEGDRT 467 Score = 37.5 bits (83), Expect = 0.010 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 6/69 (8%) Frame = +3 Query: 129 VVVDFTATWCPPCQRIAPFFE----QLPAKFPRAVFLKVDVDRCA--DTASAQGVSAMPT 290 +VV+F A WC CQ++AP +E +L + P K+D A + A+ + PT Sbjct: 49 IVVEFYAPWCGHCQKLAPEYEKAASELSSHNPPLALAKIDASEEANKEFANEYKIQGFPT 108 Query: 291 FIFYRNRTK 317 RN K Sbjct: 109 LKILRNGGK 117 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 39.5 bits (88), Expect = 0.002 Identities = 22/81 (27%), Positives = 41/81 (50%), Gaps = 2/81 (2%) Frame = +3 Query: 87 AHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPR-AVFLKVDVDRCADTAS 263 ++F++++ N+ +V+V+F A WC CQ + P +E++ + A +D D + Sbjct: 36 SNFKSKVLNSNG-VVLVEFFAPWCGHCQSLTPTWEKVASTLKGIATVAAIDADAHKSVSQ 94 Query: 264 AQGVSAMPTF-IFYRNRTKID 323 GV PT +F + ID Sbjct: 95 DYGVRGFPTIKVFVPGKPPID 115 Score = 34.7 bits (76), Expect = 0.067 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 1/80 (1%) Frame = +3 Query: 66 ATVIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFL-KVDVD 242 A+V N ++F E+ +L +V+F A WC C+++AP +++ V L V+ D Sbjct: 164 ASVELNSSNFD-ELVTESKELWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVNCD 222 Query: 243 RCADTASAQGVSAMPTFIFY 302 S V PT + + Sbjct: 223 AEQSIKSRFKVQGFPTILVF 242 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 6/69 (8%) Frame = +3 Query: 129 VVVDFTATWCPPCQRIAPFFEQ----LPAKFPRAVFLKVDV--DRCADTASAQGVSAMPT 290 +VV+F A WC C+++AP +E+ L + P V K+D + + A+ V PT Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPT 109 Query: 291 FIFYRNRTK 317 +RN K Sbjct: 110 IKIFRNGGK 118 Score = 33.9 bits (74), Expect = 0.12 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 3/66 (4%) Frame = +3 Query: 111 NAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF---PRAVFLKVDVDRCADTASAQGVSA 281 N+G K V+++F A WC CQ++AP +++ + V K+D V Sbjct: 390 NSG-KNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSVVIAKLDATANDFPKDTFDVKG 448 Query: 282 MPTFIF 299 PT F Sbjct: 449 FPTIYF 454 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 6/69 (8%) Frame = +3 Query: 129 VVVDFTATWCPPCQRIAPFFEQ----LPAKFPRAVFLKVDV--DRCADTASAQGVSAMPT 290 +VV+F A WC C+++AP +E+ L + P V K+D + + A+ V PT Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPT 109 Query: 291 FIFYRNRTK 317 +RN K Sbjct: 110 IKIFRNGGK 118 Score = 35.1 bits (77), Expect = 0.051 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 3/81 (3%) Frame = +3 Query: 111 NAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF---PRAVFLKVDVDRCADTASAQGVSA 281 N+G K V+++F A WC CQ++AP +++ + V K+D V Sbjct: 390 NSG-KNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSVVIAKLDATANDFPKDTFDVKG 448 Query: 282 MPTFIFYRNRTKIDRLEGGNT 344 PT F + EG T Sbjct: 449 FPTIYFKSASGNVVVYEGDRT 469 >At3g03860.1 68416.m00398 expressed protein Length = 300 Score = 38.7 bits (86), Expect = 0.004 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 6/118 (5%) Frame = +3 Query: 117 GTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTA-SAQGVSAMPTF 293 G + V F A+WCP + + P F+ L + FP+ L V+ + + S G+ ++P+ Sbjct: 73 GNAYMSVLFYASWCPFSRAVRPKFDMLSSMFPQIQHLAVEHSQALPSVFSRYGIHSLPSI 132 Query: 294 IFYRNRTKIDRLEGGNTTV-LENKVRQYYGSD----VAEEDEDNTVAGHMDLITFITK 452 + N+T R G + L + G VAE + AG +LIT++ K Sbjct: 133 LMV-NQTLNARYHGRKDLISLIEFYEEATGLQPVQYVAEGEPTGLNAGDGNLITWLRK 189 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 38.3 bits (85), Expect = 0.005 Identities = 23/82 (28%), Positives = 45/82 (54%), Gaps = 3/82 (3%) Frame = +3 Query: 87 AHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASA 266 ++F++++ N+ +V+V+F A WC C+ + P +E++ A + V +D A ++A Sbjct: 38 SNFKSKVLNSNG-VVLVEFFAPWCGHCKALTPTWEKV-ANILKGVATVAAIDADAHQSAA 95 Query: 267 Q--GVSAMPTF-IFYRNRTKID 323 Q G+ PT +F + ID Sbjct: 96 QDYGIKGFPTIKVFVPGKAPID 117 Score = 31.5 bits (68), Expect = 0.62 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 1/80 (1%) Frame = +3 Query: 66 ATVIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFL-KVDVD 242 A+V N ++F ++ +L +V+F A WC C+++AP +++ V L V+ D Sbjct: 163 ASVELNASNFD-DLVIESNELWIVEFFAPWCGHCKKLAPEWKRAAKNLQGKVKLGHVNCD 221 Query: 243 RCADTASAQGVSAMPTFIFY 302 S V PT + + Sbjct: 222 VEQSIMSRFKVQGFPTILVF 241 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 37.5 bits (83), Expect = 0.010 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +3 Query: 81 NDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF 209 N +F + + + K VV+F A WCP C+ P +E++ F Sbjct: 41 NTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEKVARLF 83 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 37.1 bits (82), Expect = 0.013 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 2/79 (2%) Frame = +3 Query: 72 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPR--AVFLKVDVDR 245 V+ + +F + N + V+V+F A WC CQ +AP + + V K+D Sbjct: 106 VVIKERNFTDVIEN--NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKIDATE 163 Query: 246 CADTASAQGVSAMPTFIFY 302 + A V PT +F+ Sbjct: 164 ENELAQEYRVQGFPTLLFF 182 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/63 (25%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = +3 Query: 120 TKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAV--FLKVDVDRCADTASAQGVSAMPTF 293 +K V+++ A WC CQ + P + +L AK R++ + +D + PT Sbjct: 459 SKDVLLEVYAPWCGHCQALEPMYNKL-AKHLRSIDSLVITKMDGTTNEHPKAKAEGFPTI 517 Query: 294 IFY 302 +F+ Sbjct: 518 LFF 520 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 37.1 bits (82), Expect = 0.013 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 2/79 (2%) Frame = +3 Query: 72 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPR--AVFLKVDVDR 245 V+ + +F + N + V+V+F A WC CQ +AP + + V K+D Sbjct: 106 VVIKERNFTDVIEN--NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKIDATE 163 Query: 246 CADTASAQGVSAMPTFIFY 302 + A V PT +F+ Sbjct: 164 ENELAQEYRVQGFPTLLFF 182 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/63 (25%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = +3 Query: 120 TKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAV--FLKVDVDRCADTASAQGVSAMPTF 293 +K V+++ A WC CQ + P + +L AK R++ + +D + PT Sbjct: 459 SKDVLLEVYAPWCGHCQALEPMYNKL-AKHLRSIDSLVITKMDGTTNEHPKAKAEGFPTI 517 Query: 294 IFY 302 +F+ Sbjct: 518 LFF 520 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 35.9 bits (79), Expect = 0.029 Identities = 25/108 (23%), Positives = 44/108 (40%), Gaps = 6/108 (5%) Frame = +3 Query: 132 VVDFTATWCPPCQRIAPFFEQLPAKFP-RAVFLKVDVDRCADTASAQGVSAMPT-FIF-- 299 +V+F A WC CQ + P + + A K+D D A + PT F+F Sbjct: 120 MVEFYAPWCGACQALTPEYAAAATELKGLAALAKIDATEEGDLAQKYEIQGFPTVFLFVD 179 Query: 300 --YRNRTKIDRLEGGNTTVLENKVRQYYGSDVAEEDEDNTVAGHMDLI 437 R + +R + G T L+ K + +E+ + ++ L+ Sbjct: 180 GEMRKTYEGERTKDGIVTWLKKKASPSIHNITTKEEAERVLSAEPKLV 227 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/68 (22%), Positives = 30/68 (44%), Gaps = 2/68 (2%) Frame = +3 Query: 120 TKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAV--FLKVDVDRCADTASAQGVSAMPTF 293 +K V+++ A WC CQ P + +L K+ + + + +D ++ PT Sbjct: 455 SKDVLLEIYAPWCGHCQSFEPIYNKL-GKYLKGIDSLVVAKMDGTSNEHPRAKADGFPTI 513 Query: 294 IFYRNRTK 317 +F+ K Sbjct: 514 LFFPGGNK 521 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 35.5 bits (78), Expect = 0.038 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +3 Query: 81 NDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF 209 N +F + ++ K V++F A WCP C+ P +E++ F Sbjct: 47 NATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVARLF 89 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 35.5 bits (78), Expect = 0.038 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +3 Query: 81 NDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF 209 N +F + ++ K V++F A WCP C+ P +E++ F Sbjct: 47 NATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVARLF 89 >At1g07700.3 68414.m00829 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 217 Score = 35.5 bits (78), Expect = 0.038 Identities = 27/103 (26%), Positives = 46/103 (44%), Gaps = 8/103 (7%) Frame = +3 Query: 102 EMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF----PRAVFLKVDV----DRCADT 257 E + LVVVDF T C C+ I F +L + +FLK +V D ++ Sbjct: 114 EKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNVVDEYDEQSEV 173 Query: 258 ASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYYGSD 386 A + A+P F FY+N ++ + ++ + +Y S+ Sbjct: 174 AERLRIKAVPLFHFYKNGVLLESFATRDKERIDAAILKYTSSE 216 >At1g07700.1 68414.m00828 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 204 Score = 35.5 bits (78), Expect = 0.038 Identities = 27/103 (26%), Positives = 46/103 (44%), Gaps = 8/103 (7%) Frame = +3 Query: 102 EMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF----PRAVFLKVDV----DRCADT 257 E + LVVVDF T C C+ I F +L + +FLK +V D ++ Sbjct: 101 EKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNVVDEYDEQSEV 160 Query: 258 ASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYYGSD 386 A + A+P F FY+N ++ + ++ + +Y S+ Sbjct: 161 AERLRIKAVPLFHFYKNGVLLESFATRDKERIDAAILKYTSSE 203 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 35.1 bits (77), Expect = 0.051 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 3/69 (4%) Frame = +3 Query: 102 EMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFP---RAVFLKVDVDRCADTASAQG 272 E A + K VV+F A WC C+ +AP ++ ++ V L VD + G Sbjct: 132 EEALSNGKPTVVEFYADWCEVCRELAPDVYKIEQQYKDKVNFVMLNVDNTKWEQELDEFG 191 Query: 273 VSAMPTFIF 299 V +P F F Sbjct: 192 VEGIPHFAF 200 >At5g40370.1 68418.m04897 glutaredoxin, putative similar to glutaredoxin [Ricinus communis] SWISS-PROT:P55143 Length = 111 Score = 33.5 bits (73), Expect = 0.15 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = +3 Query: 132 VVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVD 242 VV F+ T+CP C R+ +QL AKF +AV L + D Sbjct: 15 VVVFSKTYCPYCVRVKELLQQLGAKF-KAVELDTESD 50 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 33.5 bits (73), Expect = 0.15 Identities = 14/70 (20%), Positives = 33/70 (47%), Gaps = 1/70 (1%) Frame = +3 Query: 129 VVVDFTATWCPPCQRIAPFFEQLPAKFP-RAVFLKVDVDRCADTASAQGVSAMPTFIFYR 305 V+V+F +WC PC+ + +++ + + ++ D A + A+P + ++ Sbjct: 87 VLVEFYTSWCGPCRMVHRIIDEIAGDYAGKLNCYLLNADNDLPVAEEYEIKAVPVVLLFK 146 Query: 306 NRTKIDRLEG 335 N K + + G Sbjct: 147 NGEKRESIMG 156 >At5g18120.1 68418.m02127 expressed protein Length = 289 Score = 32.7 bits (71), Expect = 0.27 Identities = 17/72 (23%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Frame = +3 Query: 108 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTA-SAQGVSAM 284 AN G + + F + CP + + P F+ L + FP L V+ + + S G+ ++ Sbjct: 66 ANHGNAYISILFYTSRCPFSRAVRPKFDVLSSMFPHITHLIVEQSQALPSVFSRYGIHSL 125 Query: 285 PTFIFYRNRTKI 320 P+ + K+ Sbjct: 126 PSILMVNQTMKM 137 >At1g60420.1 68414.m06802 DC1 domain-containing protein contains Pfam domain PF03107: DC1 domain Length = 578 Score = 31.5 bits (68), Expect = 0.62 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +3 Query: 72 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAP 182 +++ND Q ++ + K + + F+A WC PCQR P Sbjct: 28 LVRNDGE-QVKVDSLLGKKIGLYFSAAWCGPCQRFTP 63 Score = 30.3 bits (65), Expect = 1.4 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 123 KLVVVDFTATWCPPCQRIAP 182 K +++ F+A WCPPC+ P Sbjct: 364 KTILMYFSAHWCPPCRAFTP 383 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 31.1 bits (67), Expect = 0.83 Identities = 20/80 (25%), Positives = 33/80 (41%), Gaps = 4/80 (5%) Frame = +3 Query: 117 GTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPR----AVFLKVDVDRCADTASAQGVSAM 284 G + V+V A WC + P F + + K+D DR + AS + Sbjct: 93 GNEFVMVLGYAPWCARSAELMPRFAEAATALKEIGSSVLMAKIDGDRYSKIASELEIKGF 152 Query: 285 PTFIFYRNRTKIDRLEGGNT 344 PT + + N T + GG++ Sbjct: 153 PTLLLFVNGTSL-TYNGGSS 171 >At4g08930.1 68417.m01470 thioredoxin-related contains weak similarity to Swiss-Prot:Q39239 thioredoxin H-type 4 (TRX-H-4). [Mouse-ear cress] Length = 295 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/69 (27%), Positives = 28/69 (40%), Gaps = 1/69 (1%) Frame = +3 Query: 141 FTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRC-ADTASAQGVSAMPTFIFYRNRTK 317 F A+WCP + + P F+ + + ++ A T S GV PT I N T Sbjct: 81 FYASWCPFSRLVRPSFDLMSLLYSSVPHFAIEESSVKASTLSKYGVHGFPTIIL-MNSTM 139 Query: 318 IDRLEGGNT 344 + G T Sbjct: 140 LVVYRGSRT 148 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 29.9 bits (64), Expect = 1.9 Identities = 22/108 (20%), Positives = 43/108 (39%), Gaps = 4/108 (3%) Frame = +3 Query: 117 GTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPR----AVFLKVDVDRCADTASAQGVSAM 284 G + V+V A WC + P F + + K+D +R + AS + Sbjct: 91 GNEYVMVLGYAPWCARSAELMPRFAEAATDLKEIGSSVLMAKIDGERYSKVASQLEIKGF 150 Query: 285 PTFIFYRNRTKIDRLEGGNTTVLENKVRQYYGSDVAEEDEDNTVAGHM 428 PT + + N T G ++ + V++ G+ + D + +G + Sbjct: 151 PTLLLFVNGTSQSYTGGFSSEEIVIWVQKKTGASTIKLDTVDEASGFL 198 >At5g02370.1 68418.m00160 kinesin motor protein-related kinesin, Xenopus laevis, EMBL:XLA249840 Length = 628 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -2 Query: 233 YFEKYCSRKLCW*LLEKRGNPLARWTPSCCKVH 135 Y+E Y R CW LLE + N +A W +VH Sbjct: 156 YYEVYMDR--CWDLLEVKDNEIAVWDDKDGQVH 186 >At4g40020.1 68417.m05666 hypothetical protein Length = 615 Score = 28.7 bits (61), Expect = 4.4 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +3 Query: 351 LENKVRQYYGS-DVAEEDEDNTVAGHMDLITFITKSECECLNEADDHPLAQA 503 L+ K+ Y S D +EEDED++ D+ + T+ E + A H AQA Sbjct: 95 LKEKIDTSYNSQDSSEEDEDDSSVQDFDIESLKTEMESTKESLAQAHEAAQA 146 >At1g34780.1 68414.m04329 protein disulfide isomerase-related contains weak similarity to Pfam:P08003 protein disulfide isomerase A4 precursor (Protein ERp-72, ERp72) [Mus musculus] Length = 310 Score = 28.3 bits (60), Expect = 5.8 Identities = 25/88 (28%), Positives = 37/88 (42%), Gaps = 1/88 (1%) Frame = +3 Query: 129 VVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRC-ADTASAQGVSAMPTFIFYR 305 V + F A+WCP + P F+ + + + + T S GV PT + Sbjct: 84 VALLFYASWCPFSRSFRPSFDVISSLYSSIPHFAIKESSIKPSTLSKYGVHGFPTLLLL- 142 Query: 306 NRTKIDRLEGGNTTVLENKVRQYYGSDV 389 N T R G T +L++ V Y SDV Sbjct: 143 NSTMRARYRG--TRMLDSLVAFY--SDV 166 >At1g15740.1 68414.m01888 leucine-rich repeat family protein Length = 585 Score = 27.9 bits (59), Expect = 7.7 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +3 Query: 459 CECLNEADDHPLAQALTNDRGYLASYCDEQLIINISF-NQLVKLHSIKIKG 608 C C+ +AD PL+ LTN R L C + I IS+ L KL+ + ++G Sbjct: 246 CNCITDADMEPLS-VLTNLRS-LQICCSKITDIGISYLKGLNKLNLLNLEG 294 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,614,488 Number of Sequences: 28952 Number of extensions: 271251 Number of successful extensions: 834 Number of sequences better than 10.0: 69 Number of HSP's better than 10.0 without gapping: 788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 821 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1682736544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -