BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0624 (726 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 26 0.42 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 26 0.42 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 24 1.3 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 24 1.3 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 24 1.3 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 24 1.3 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 24 1.7 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 24 1.7 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 24 1.7 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 24 1.7 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 24 1.7 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 24 1.7 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 24 1.7 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 23 2.2 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 23 2.9 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 23 2.9 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 2.9 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 2.9 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 5.1 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 22 6.8 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 22 6.8 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 22 6.8 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 22 6.8 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 22 6.8 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 22 6.8 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 9.0 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 21 9.0 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.8 bits (54), Expect = 0.42 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 703 IAANLSFRSLYNNHYSY*KLYQNNFNEFGIDTTLIY 596 I ++LS +++NN+Y Y NN+N + L Y Sbjct: 80 IISSLSNNTIHNNNYKY-NYNNNNYNNNNYNKKLYY 114 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.8 bits (54), Expect = 0.42 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 703 IAANLSFRSLYNNHYSY*KLYQNNFNEFGIDTTLIY 596 I ++LS +++NN+Y Y NN+N + L Y Sbjct: 80 IISSLSNNTIHNNNYKY-NYNNNNYNNNNYNKKLYY 114 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -3 Query: 703 IAANLSFRSLYNNHYSY*KLYQNNFNE 623 I ++LS +++NN+Y Y NN+N+ Sbjct: 81 IISSLSNNTIHNNNYKY-NYNNNNYNK 106 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -3 Query: 703 IAANLSFRSLYNNHYSY*KLYQNNFNE 623 I ++LS +++NN+Y Y NN+N+ Sbjct: 81 IISSLSNNTIHNNNYKY-NYNNNNYNK 106 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -3 Query: 703 IAANLSFRSLYNNHYSY*KLYQNNFNE 623 I ++LS +++NN+Y Y NN+N+ Sbjct: 81 IISSLSNNTIHNNNYKY-NYNNNNYNK 106 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -3 Query: 703 IAANLSFRSLYNNHYSY*KLYQNNFNE 623 I ++LS +++NN+Y Y NN+N+ Sbjct: 81 IISSLSNNTIHNNNYKY-NYNNNNYNK 106 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 Query: 703 IAANLSFRSLYNNHYSY*KLYQNNFN 626 I ++LS Y+N+ +Y Y NN+N Sbjct: 81 IISSLSNNYKYSNYNNYNNNYNNNYN 106 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 Query: 703 IAANLSFRSLYNNHYSY*KLYQNNFN 626 I ++LS Y+N+ +Y Y NN+N Sbjct: 81 IISSLSNNYKYSNYNNYNNNYNNNYN 106 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 703 IAANLSFRSLYNNHYSY*KLYQNNFN 626 I ++LS ++++NN+ +Y KL N N Sbjct: 81 IISSLSNKTIHNNNNNYKKLQYYNIN 106 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 703 IAANLSFRSLYNNHYSY*KLYQNNFN 626 I ++LS ++++NN+ +Y KL N N Sbjct: 81 IISSLSNKTIHNNNNNYKKLQYYNIN 106 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 703 IAANLSFRSLYNNHYSY*KLYQNNFN 626 I ++LS ++++NN+ +Y KL N N Sbjct: 81 IISSLSNKTIHNNNNNYKKLQYYNIN 106 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 703 IAANLSFRSLYNNHYSY*KLYQNNFN 626 I ++LS ++++NN+ +Y KL N N Sbjct: 81 IISSLSNKTIHNNNNNYKKLQYYNIN 106 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 703 IAANLSFRSLYNNHYSY*KLYQNNFN 626 I ++LS ++++NN+ +Y KL N N Sbjct: 314 IISSLSNKTIHNNNNNYKKLQYYNIN 339 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = -3 Query: 703 IAANLSFRSLYNNHYSY*KLYQNNFNEF 620 I ++LS ++++NN+ Y NN+N + Sbjct: 314 IISSLSNKTIHNNNNYNNNNYNNNYNNY 341 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 2.9 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = -3 Query: 721 PFRIGYIAANLSFRSLYNNHYSY*KLYQNNFNEFGIDTTLIYGNKP 584 P I ++ N ++ + NN+Y N+ + + + YGN P Sbjct: 79 PKIISSLSNNYNYSNYNNNNYKQLCYNINHIEQIPVPVPVYYGNFP 124 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 694 NLSFRSLYNNHYSY*KLYQNNFN 626 N ++++ YNN+Y+ KLY N N Sbjct: 308 NYNYKN-YNNNYNSKKLYYNIIN 329 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 694 NLSFRSLYNNHYSY*KLYQNNFN 626 N ++++ YNN+Y+ KLY N N Sbjct: 319 NYNYKN-YNNNYNSKKLYYNIIN 340 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 673 YNNHYSY*KLYQNNFN 626 YNN+Y+ Y NN+N Sbjct: 330 YNNNYNNYNNYNNNYN 345 Score = 22.2 bits (45), Expect = 5.1 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = -3 Query: 688 SFRSLYNNHYSY*KLYQNNFNE 623 ++ + YNN+ +Y Y NN+ + Sbjct: 329 NYNNNYNNYNNYNNNYNNNYKK 350 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.2 bits (45), Expect = 5.1 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -3 Query: 703 IAANLSFRSLYNNHYSY*KLYQNNFNEF 620 I ++LS Y+N+ +Y NN+N + Sbjct: 314 IISSLSNNYKYSNYNNYNNYNNNNYNNY 341 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 276 NSHENNPSAFFFAANQK 226 + H+N+PS F NQK Sbjct: 397 DDHQNSPSIFISDDNQK 413 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.8 Identities = 11/46 (23%), Positives = 20/46 (43%) Frame = -3 Query: 721 PFRIGYIAANLSFRSLYNNHYSY*KLYQNNFNEFGIDTTLIYGNKP 584 P I ++ N ++ + NN+Y N + + + YGN P Sbjct: 79 PKIISSLSNNYNYSNYNNNNYKQLCYNINYIEQIPVPVPVYYGNFP 124 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.8 Identities = 11/46 (23%), Positives = 20/46 (43%) Frame = -3 Query: 721 PFRIGYIAANLSFRSLYNNHYSY*KLYQNNFNEFGIDTTLIYGNKP 584 P I ++ N ++ + NN+Y N + + + YGN P Sbjct: 79 PKIISSLSNNYNYSNYNNNNYKQLCYNINYIEQIPVPVPVYYGNFP 124 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.8 Identities = 11/46 (23%), Positives = 20/46 (43%) Frame = -3 Query: 721 PFRIGYIAANLSFRSLYNNHYSY*KLYQNNFNEFGIDTTLIYGNKP 584 P I ++ N ++ + NN+Y N + + + YGN P Sbjct: 79 PKIISSLSNNYNYSNYNNNNYKQLCYNINYIEQIPVPVPVYYGNFP 124 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.8 Identities = 11/46 (23%), Positives = 20/46 (43%) Frame = -3 Query: 721 PFRIGYIAANLSFRSLYNNHYSY*KLYQNNFNEFGIDTTLIYGNKP 584 P I ++ N ++ + NN+Y N + + + YGN P Sbjct: 79 PKIISSLSNNYNYSNYNNNNYKQLCYNINYIEQIPVPVPVYYGNFP 124 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.8 Identities = 11/46 (23%), Positives = 20/46 (43%) Frame = -3 Query: 721 PFRIGYIAANLSFRSLYNNHYSY*KLYQNNFNEFGIDTTLIYGNKP 584 P I ++ N ++ + NN+Y N + + + YGN P Sbjct: 79 PKIISSLSNNYNYSNYNNNNYKQLCYNINYIEQIPVPVPVYYGNFP 124 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.4 bits (43), Expect = 9.0 Identities = 11/27 (40%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = -3 Query: 703 IAANLSFRSLY-NNHYSY*KLYQNNFN 626 I ++LS R+++ NN+Y Y NN+N Sbjct: 81 IISSLSNRTIHNNNNYKY-NYNNNNYN 106 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +1 Query: 397 EIDMVHHASLSWKKYINL 450 E+D+ + WKK +NL Sbjct: 83 EVDLEFYLGKEWKKNLNL 100 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,688 Number of Sequences: 438 Number of extensions: 4308 Number of successful extensions: 34 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -