BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0622 (625 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-... 23 3.2 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 5.6 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 22 5.6 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 5.6 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 7.4 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 9.8 >M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E60. ). Length = 109 Score = 22.6 bits (46), Expect = 3.2 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 33 SRRTLPINERGSGGDVVAKEPKTQPSG 113 +RR + RG+GG K P+T SG Sbjct: 3 TRRVKRSDGRGNGGTPEEKRPRTAFSG 29 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.8 bits (44), Expect = 5.6 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +1 Query: 88 KNQKLSPQVRSTATLPVRDDVSLLMLHSIH 177 +N PQ + AT+P+ + M+H +H Sbjct: 301 RNGLAFPQRETGATVPLHMQKYVQMIHDLH 330 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 21.8 bits (44), Expect = 5.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 301 IVITCENKFSKSWLH 257 I+ITC + SKS +H Sbjct: 60 ILITCRKRVSKSRIH 74 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.8 bits (44), Expect = 5.6 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +1 Query: 88 KNQKLSPQVRSTATLPVRDDVSLLMLHSIH 177 +N PQ + AT+P+ + M+H +H Sbjct: 301 RNGLAFPQRETGATVPLHMQKYVQMIHDLH 330 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 53 DRQGAPRAGEVGFGSEG 3 D G P E+GF +EG Sbjct: 206 DHYGVPTLEELGFDTEG 222 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -2 Query: 447 FHNYSNSHIFDYIKKHSYDIERLNI 373 ++NY+N++ +Y KK Y +NI Sbjct: 330 YNNYNNNNYNNYNKKLYYKNYIINI 354 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,989 Number of Sequences: 438 Number of extensions: 2612 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18582456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -