BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0621 (756 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24730| Best HMM Match : Kinesin (HMM E-Value=2.3e-17) 30 1.8 SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_26161| Best HMM Match : Herpes_LP (HMM E-Value=1.7) 28 7.1 SB_7996| Best HMM Match : efhand (HMM E-Value=1.4) 28 9.4 >SB_24730| Best HMM Match : Kinesin (HMM E-Value=2.3e-17) Length = 602 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +1 Query: 277 LLSKALGVDFILIVIICVNVSPKYGSDTLINLGYCLRS 390 LL+ +LG D + ++I C++ S SDTL L Y R+ Sbjct: 127 LLADSLGGDGVTLMIACISPSSSVVSDTLNTLRYANRA 164 >SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1018 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +3 Query: 3 PRPSEPKPTSPARG-APCRPTNEAL 74 P PS P PT P R P P++EAL Sbjct: 298 PTPSPPTPTPPPRSPTPLHPSSEAL 322 >SB_26161| Best HMM Match : Herpes_LP (HMM E-Value=1.7) Length = 412 Score = 28.3 bits (60), Expect = 7.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 3 PRPSEPKPTSPARGAPCR 56 PRPS PKPT P CR Sbjct: 299 PRPSRPKPTLPPFAEKCR 316 >SB_7996| Best HMM Match : efhand (HMM E-Value=1.4) Length = 570 Score = 27.9 bits (59), Expect = 9.4 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 4/47 (8%) Frame = +1 Query: 310 LIVIICVNVSPKYG----SDTLINLGYCLRSLVSTFLQRTPAIRESL 438 L V ICV + KYG D L N G+C +T ++ A+ + + Sbjct: 390 LQVSICVTLDHKYGLRDLIDLLSNFGFCASYFEATLYKKNAAVTQGV 436 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,152,810 Number of Sequences: 59808 Number of extensions: 404412 Number of successful extensions: 1228 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1227 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -