BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0616 (674 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0706 + 19627024-19627380,19629945-19629976,19630657-196307... 43 3e-04 02_04_0653 - 24747959-24748276,24748847-24748959,24749815-247500... 42 3e-04 12_02_1012 - 25281820-25281987,25282337-25282409,25283370-252834... 41 8e-04 02_02_0568 + 11577804-11578676,11578956-11579042,11579043-11579141 41 8e-04 07_03_1375 + 26120094-26120651 39 0.004 12_01_0672 + 5731288-5731356,5732032-5732117,5732634-5732724,573... 38 0.006 04_04_0897 - 29186821-29187459 38 0.006 04_01_0399 - 5214183-5214206,5215437-5215502,5219537-5219635,521... 38 0.007 06_02_0066 - 11081446-11081544,11081639-11081846,11083122-110832... 38 0.010 07_03_1651 - 28395369-28395436,28395524-28395575,28395857-283960... 37 0.013 03_05_0513 - 25073518-25073623,25073719-25073777,25074048-250741... 37 0.017 01_01_0475 + 3500385-3500880,3501078-3501154,3501851-3502019,350... 37 0.017 03_02_0534 - 9267297-9267734,9268376-9268649,9268782-9268889,926... 36 0.022 01_01_1146 + 9087154-9087768 36 0.022 12_01_0961 + 9566730-9566998,9567096-9567187,9567294-9567427,956... 35 0.052 01_06_0919 - 32993752-32993856,32994383-32994592,32994666-329952... 35 0.052 02_05_0316 - 27825871-27826509 35 0.068 06_01_0063 - 534138-534605 34 0.090 04_04_0057 + 22410167-22411330 34 0.12 02_04_0056 + 19313422-19313967,19314035-19314168,19314263-193143... 34 0.12 09_04_0521 - 18297343-18297840 33 0.16 04_03_0205 + 12649724-12650191,12651493-12652025,12652114-126522... 33 0.16 03_05_1082 - 30239385-30239561,30239937-30240009,30240382-302404... 33 0.16 12_02_0895 + 24094809-24094886,24097197-24097402,24097493-24097919 33 0.21 08_02_1329 - 26182762-26183007,26183149-26183249,26183533-261836... 33 0.21 05_01_0018 + 125697-126130,126231-126356,126726-126825,126950-12... 33 0.21 08_02_1103 - 24329120-24329623 33 0.28 08_01_0413 - 3679887-3681254 33 0.28 05_03_0471 - 14455543-14455650,14455925-14456002,14456121-144562... 33 0.28 04_04_0717 - 27525117-27525248,27525384-27525549,27525629-275258... 33 0.28 02_03_0412 - 18749430-18749587,18749696-18749857,18750062-187501... 33 0.28 05_05_0173 + 22956927-22958615 32 0.36 01_06_1819 + 40110697-40110721,40110818-40110828,40111228-401115... 32 0.36 01_06_0829 - 32270189-32270863 32 0.48 08_02_1143 + 24659105-24659386,24660171-24660272,24661259-246615... 31 0.64 05_04_0190 - 18922555-18923349 31 0.64 03_02_0915 + 12360079-12360095,12360225-12361353 31 0.64 07_03_1696 - 28779455-28779733,28779813-28780074,28780805-287809... 31 0.84 03_05_0500 + 24942047-24942541 31 0.84 07_03_1730 - 29099262-29099807 31 1.1 05_05_0352 + 24328117-24328303,24328451-24328559,24330634-243306... 31 1.1 03_03_0152 + 14908778-14909344 31 1.1 01_06_1007 - 33733500-33733604,33733837-33733917,33734191-337342... 31 1.1 01_01_0797 - 6198401-6199114 31 1.1 09_04_0233 - 15890085-15890234,15890345-15890551,15891112-158913... 30 1.5 02_05_0890 - 32546918-32547088,32547224-32547334,32547705-325478... 30 1.5 03_01_0627 - 4598655-4599716 30 1.9 10_08_0961 + 21869612-21869773,21869869-21869956,21870047-218702... 29 2.6 03_05_0677 + 26663880-26664581 29 2.6 01_06_1224 - 35508842-35510404 29 2.6 12_02_1243 + 27300978-27301682 29 3.4 09_06_0247 + 21844311-21845646,21845991-21846118 29 3.4 09_04_0651 - 19224403-19225032 29 3.4 07_03_1304 - 25629822-25629839,25630091-25631148,25631784-256349... 29 3.4 03_04_0142 - 17656751-17657554 29 3.4 12_01_0052 + 433203-433292,433409-433815,434435-434447,437081-43... 29 4.5 11_01_0051 + 391254-391343,391460-391862,392345-392352,393627-39... 29 4.5 07_03_0535 - 19198130-19198139,19199901-19199995,19200095-192001... 29 4.5 04_04_0905 - 29290998-29291486 29 4.5 03_01_0471 + 3629158-3629185,3630027-3630058,3630272-3630344,363... 29 4.5 07_03_1459 + 26681619-26682419,26682600-26682912,26683861-26684672 28 5.9 04_04_1247 - 32043776-32043880,32044296-32044505,32044595-320451... 28 5.9 03_02_0670 - 10303538-10303930,10304349-10305444,10305831-10306228 28 5.9 01_06_0715 + 31416338-31416500,31416601-31416710,31416808-314168... 28 5.9 01_01_0145 + 1327172-1327362,1327491-1328169 28 5.9 12_02_1214 - 27061794-27062178,27063018-27063766,27064427-27064831 28 7.8 12_02_0132 - 14054331-14054969 28 7.8 11_06_0155 - 20712601-20713553,20713618-20714000,20714240-207142... 28 7.8 10_08_0150 + 15227739-15228140 28 7.8 08_01_0376 - 3320621-3321151 28 7.8 04_03_0747 - 19251617-19251781,19252377-19252502,19252606-192527... 28 7.8 03_05_0377 + 23613181-23613342,23614469-23614501,23614606-236148... 28 7.8 02_05_0391 + 28563242-28563302,28563714-28563931,28564563-285646... 28 7.8 >09_04_0706 + 19627024-19627380,19629945-19629976,19630657-19630751, 19632116-19632281,19632881-19632938,19633014-19633061, 19633274-19633464,19633580-19633702,19635174-19635289, 19635841-19635924,19636009-19636259,19636438-19636647 Length = 576 Score = 42.7 bits (96), Expect = 3e-04 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACL 444 D C IC+E DP VLNC H +C CL Sbjct: 403 DVACLICQELLFDPSVLNCGHVYCMPCL 430 >02_04_0653 - 24747959-24748276,24748847-24748959,24749815-24750015, 24750097-24750267,24750354-24750425,24751515-24751543, 24752161-24752303 Length = 348 Score = 42.3 bits (95), Expect = 3e-04 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACL 444 D +CA+C+E P VLNC H +C +CL Sbjct: 118 DVSCALCKELLYQPAVLNCGHVYCMSCL 145 >12_02_1012 - 25281820-25281987,25282337-25282409,25283370-25283420, 25283523-25283932,25284083-25284413,25285340-25285439, 25287091-25287370 Length = 470 Score = 41.1 bits (92), Expect = 8e-04 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 367 TCAICRETFIDPKVLN-CFHTFCRACLDREQTHPDRVTCVTCRVDTQLPP 513 TC +CR D ++ C HTFCR C+ ++ + C C++D P Sbjct: 73 TCPLCRRILRDATTVSECLHTFCRKCIYKKINDEELEHCPVCKIDLGCAP 122 >02_02_0568 + 11577804-11578676,11578956-11579042,11579043-11579141 Length = 352 Score = 41.1 bits (92), Expect = 8e-04 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +1 Query: 346 DFDGLDTTCAICRETFIDPKVLNCFHTFCRAC 441 D + L C ICRE F+DP V C H FC C Sbjct: 257 DEEALPFACYICREPFVDPVVTKCKHYFCEHC 288 >07_03_1375 + 26120094-26120651 Length = 185 Score = 38.7 bits (86), Expect = 0.004 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 8/60 (13%) Frame = +1 Query: 295 LSGSSPPASDSAVCDLR------DFDGLDTT--CAICRETFIDPKVLNCFHTFCRACLDR 450 L G PPAS +A+ L+ D +G D+ CAIC + F K + C H F CL+R Sbjct: 56 LGGGVPPASKAAIASLKEVKAGEDGEGGDSLGDCAICLDAFAAGKEMPCGHRFHSECLER 115 >12_01_0672 + 5731288-5731356,5732032-5732117,5732634-5732724, 5732886-5732935,5733339-5733408,5733508-5733617, 5733943-5734463,5734856-5734949,5735095-5735225, 5735241-5736274,5736383-5736457,5736615-5737104, 5737375-5738009,5738166-5738378 Length = 1222 Score = 38.3 bits (85), Expect = 0.006 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +1 Query: 337 DLRDFDGLDTTCAICRETFIDPKVLNCF-HTFCRACLDREQTHPDRVTCVTCRVDTQ 504 DL + + +C ICR+ ID VL+C H FC C+D +R C C+ + Q Sbjct: 22 DLETYAFENESCGICRDIVIDRGVLDCCQHWFCYTCIDNWSAITNR--CPLCKSEFQ 76 >04_04_0897 - 29186821-29187459 Length = 212 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +1 Query: 403 KVLNCFHTFCRACLDREQTHPDRVTCVTCR 492 ++ NC H F R CLDR H D+ TC CR Sbjct: 127 RLSNCRHVFHRGCLDRWMEHDDQRTCPLCR 156 >04_01_0399 - 5214183-5214206,5215437-5215502,5219537-5219635, 5219746-5219817,5219918-5220491,5220575-5220687, 5220842-5220941,5221059-5221181,5221268-5221335, 5221461-5221610,5221715-5221858,5222097-5222288, 5222710-5222794,5222892-5223043,5223138-5223296, 5223552-5223605,5223698-5223836,5223955-5224088, 5224200-5225117 Length = 1121 Score = 37.9 bits (84), Expect = 0.007 Identities = 24/67 (35%), Positives = 30/67 (44%), Gaps = 4/67 (5%) Frame = +1 Query: 304 SSPPAS---DSAVCDLRDFDGLDTTCAICRETFIDPKVLN-CFHTFCRACLDREQTHPDR 471 S+PP+ + V ++R G T C IC E+ D VL C H CR CL P Sbjct: 873 SAPPSQAYVEEVVEEIRQ--GATTECPICLESASDDPVLTPCAHRMCRECLLSSWRTPSG 930 Query: 472 VTCVTCR 492 C CR Sbjct: 931 GPCPLCR 937 >06_02_0066 - 11081446-11081544,11081639-11081846,11083122-11083257, 11083339-11083541,11083616-11083765,11083848-11083964, 11084623-11085119 Length = 469 Score = 37.5 bits (83), Expect = 0.010 Identities = 24/58 (41%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Frame = +1 Query: 346 DFDGLDTTCAICRETFIDPKVLNCFHTFCRACLDR--EQTHPDRVTCVTCRVDTQLPP 513 + + D TC ICRE K L C H F CL E+ H TC TCR LPP Sbjct: 252 ELNASDATCIICREEMTTAKKLLCGHLFHVHCLRSWLERQH----TCPTCRAPI-LPP 304 >07_03_1651 - 28395369-28395436,28395524-28395575,28395857-28396092, 28396362-28396419,28396509-28396577,28396686-28396791, 28397104-28397171,28397266-28397385,28398144-28398231, 28399433-28399534,28399699-28399757,28399866-28400003, 28400222-28400473,28400508-28400593,28401061-28401165, 28402351-28402516 Length = 590 Score = 37.1 bits (82), Expect = 0.013 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +1 Query: 334 CDLRDFDGLDT--TCAICRETFIDPKVLNCFHTFCRAC 441 C+L D +D TC+IC +T DP L+C H +C C Sbjct: 185 CNLFDSMRVDISLTCSICLDTVFDPVALSCGHIYCYLC 222 >03_05_0513 - 25073518-25073623,25073719-25073777,25074048-25074185, 25074719-25074982,25075062-25075306,25075874-25076081 Length = 339 Score = 36.7 bits (81), Expect = 0.017 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 367 TCAICRETFIDPKVLNCFHTFCRAC 441 TC IC +T +P L+C H FC+ C Sbjct: 234 TCPICLDTLFNPYALSCGHLFCKGC 258 >01_01_0475 + 3500385-3500880,3501078-3501154,3501851-3502019, 3502385-3502473,3502601-3502765,3502841-3502918, 3503087-3503190,3503317-3503422 Length = 427 Score = 36.7 bits (81), Expect = 0.017 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTCVTCR 492 CAIC+E P +L C H FC C+ E +R TC CR Sbjct: 366 CAICQEKMHTPILLRCKHIFCEDCVS-EWFERER-TCPLCR 404 >03_02_0534 - 9267297-9267734,9268376-9268649,9268782-9268889, 9269476-9269567,9269652-9269711,9269812-9269994 Length = 384 Score = 36.3 bits (80), Expect = 0.022 Identities = 34/121 (28%), Positives = 47/121 (38%), Gaps = 9/121 (7%) Frame = +1 Query: 277 SISPLTL---SGSSPPASDSAVCDLRDFDGLDTTCAICRETFIDPKVLNCFHTFCRACLD 447 S SPL L S S A D+A+ + G C+IC E +V C H C AC Sbjct: 216 SASPLALPSPSRSDDGAHDAAISEEAAAAGGGEVCSICFEQACTIEVRECGHQMCAACTL 275 Query: 448 REQTH--PDRVTCVTCRVDTQLPP---GGVDSL-LTNLVIAAAVDQDAELLSSGRQTSSP 609 H P C+ P GG+ L + A D + + +G + +SP Sbjct: 276 ALCCHAKPSAAAATPCQQPLPTCPFCRGGISRLVVATTKTRAGGDDEEDDEEAGSRLASP 335 Query: 610 L 612 L Sbjct: 336 L 336 >01_01_1146 + 9087154-9087768 Length = 204 Score = 36.3 bits (80), Expect = 0.022 Identities = 24/60 (40%), Positives = 25/60 (41%), Gaps = 3/60 (5%) Frame = +1 Query: 343 RDFDGLDTTCAICRETFIDP---KVLNCFHTFCRACLDREQTHPDRVTCVTCRVDTQLPP 513 R D C C D + L C H F RACLD P R TC CR D LPP Sbjct: 94 RGRDAAPVDCVFCLSRVDDGEEVRELRCRHVFHRACLDAWLVLP-RATCPLCR-DCLLPP 151 >12_01_0961 + 9566730-9566998,9567096-9567187,9567294-9567427, 9567542-9567591,9569026-9569100,9569179-9569734 Length = 391 Score = 35.1 bits (77), Expect = 0.052 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTCVTCR 492 + +CAIC E +P C H+FC CL + C CR Sbjct: 161 ELSCAICLEICFEPSTTPCGHSFCMKCLKHAAAKCGK-RCPKCR 203 >01_06_0919 - 32993752-32993856,32994383-32994592,32994666-32995220, 32995705-32995926,32996381-32996511,32997456-32998353, 32998453-32998530,32998612-32998683,32998728-32998763, 32999413-33000353,33000531-33000659,33000751-33000894, 33000994-33001060,33002434-33002502,33003144-33003278 Length = 1263 Score = 35.1 bits (77), Expect = 0.052 Identities = 25/81 (30%), Positives = 35/81 (43%), Gaps = 5/81 (6%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTCVT-CRV---DTQL-PPGGVDSLL 534 CA+C + D V C H FC C+ + T D V V+ CRV T L G ++ L Sbjct: 970 CALCNDAPEDAVVTICGHVFCNQCILEQLTGDDSVCPVSNCRVRLNSTSLFSRGTLECAL 1029 Query: 535 TNLVIAAAVDQDAELLSSGRQ 597 + D E + G+Q Sbjct: 1030 SRSTCEFLSDDSCEDMVQGKQ 1050 >02_05_0316 - 27825871-27826509 Length = 212 Score = 34.7 bits (76), Expect = 0.068 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +1 Query: 403 KVLNCFHTFCRACLDREQTHPDRVTCVTCR 492 ++ NC H F R CLDR H R TC CR Sbjct: 131 RLSNCRHVFHRGCLDRWMAHEQR-TCPLCR 159 >06_01_0063 - 534138-534605 Length = 155 Score = 34.3 bits (75), Expect = 0.090 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 4/68 (5%) Frame = +1 Query: 367 TCAICRETFIDP----KVLNCFHTFCRACLDREQTHPDRVTCVTCRVDTQLPPGGVDSLL 534 TCA+C F + C H F RACLD H R TC CR + L P +L Sbjct: 91 TCAVCLRDFHKSAQVRRAHRCRHVFHRACLDAWAHHGHR-TCPLCR--SPLLPSSAPPVL 147 Query: 535 TNLVIAAA 558 L + A+ Sbjct: 148 LPLPLPAS 155 >04_04_0057 + 22410167-22411330 Length = 387 Score = 33.9 bits (74), Expect = 0.12 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Frame = +1 Query: 370 CAICRETFIDPKVL----NCFHTFCRACLDREQTHPDRVTCVTCRVDTQLPP 513 CA+C +F D L +C H F C+D RVTC CR + + PP Sbjct: 133 CAVCLTSFDDGDDLRLLPHCSHAFHPECID--PWLESRVTCPLCRANLEKPP 182 >02_04_0056 + 19313422-19313967,19314035-19314168,19314263-19314398, 19314870-19314923,19314995-19315135,19315220-19315546, 19315647-19315916,19316080-19316226,19316890-19317045, 19317223-19317290,19318210-19318309,19318696-19318985, 19319074-19319274,19319840-19319902,19320263-19320356, 19320964-19321035,19321979-19322077,19322254-19322376 Length = 1006 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTCVTCR 492 C IC E F D + C H CR CL C CR Sbjct: 750 CPICLEAFEDAVLTPCAHRLCRECLLSSWRSASAGLCPVCR 790 >09_04_0521 - 18297343-18297840 Length = 165 Score = 33.5 bits (73), Expect = 0.16 Identities = 22/66 (33%), Positives = 28/66 (42%), Gaps = 7/66 (10%) Frame = +1 Query: 355 GLDTTCAICRETFIDPKVLN---CFHTFCRACLDREQTHPDRVTCVTCR----VDTQLPP 513 G C +C F V+N C H F RACL+ + D TC CR D+ PP Sbjct: 98 GATADCRVCLVRFEAEAVVNRLPCGHIFHRACLETWLDY-DHATCPLCRSRLLADSSSPP 156 Query: 514 GGVDSL 531 +L Sbjct: 157 AAAAAL 162 >04_03_0205 + 12649724-12650191,12651493-12652025,12652114-12652239, 12652625-12652724,12652880-12652899,12653035-12653137, 12653213-12653351,12653448-12653662,12653772-12654320 Length = 750 Score = 33.5 bits (73), Expect = 0.16 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACL 444 C+ICR +P C H FC+ CL Sbjct: 500 CSICRNVMEEPVTTPCAHNFCKKCL 524 >03_05_1082 - 30239385-30239561,30239937-30240009,30240382-30240432, 30240521-30240978,30241099-30241435,30241836-30241935, 30243880-30244003 Length = 439 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/50 (26%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +1 Query: 367 TCAICRETFIDPKVLN-CFHTFCRACLDREQTHPDRVTCVTCRVDTQLPP 513 TC +C+ + + C HTFC+ C+ + + C C +D P Sbjct: 21 TCPLCKGLLREATAITECLHTFCKECIMEKIDDEEVDHCPVCNIDLGCDP 70 >12_02_0895 + 24094809-24094886,24097197-24097402,24097493-24097919 Length = 236 Score = 33.1 bits (72), Expect = 0.21 Identities = 26/75 (34%), Positives = 30/75 (40%), Gaps = 6/75 (8%) Frame = +1 Query: 313 PASDSAVCDLRDFD---GLDTTCAICRETFIDPK---VLNCFHTFCRACLDREQTHPDRV 474 P + A C + D D G T C+IC E D L C H F ACL+R R Sbjct: 164 PTQEVASCRVTDDDELAGPSTECSICLERCGDADGLLELRCKHIFHSACLERWLR--SRS 221 Query: 475 TCVTCRVDTQLPPGG 519 C CR L G Sbjct: 222 DCPYCRASVLLTAEG 236 >08_02_1329 - 26182762-26183007,26183149-26183249,26183533-26183602, 26183692-26183895,26186435-26186941,26188672-26188677 Length = 377 Score = 33.1 bits (72), Expect = 0.21 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = +1 Query: 367 TCAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTCVTCR 492 TC +C P NC H FC C+ + + C TCR Sbjct: 318 TCPVCLNKLDKPSTTNCGHIFCEKCI--QAWLKAQKKCPTCR 357 >05_01_0018 + 125697-126130,126231-126356,126726-126825,126950-126969, 127118-127220,127331-127469,127577-127791,127873-128523 Length = 595 Score = 33.1 bits (72), Expect = 0.21 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACL 444 C+IC++ +P C H FC+ CL Sbjct: 311 CSICKQVMKEPLTTPCAHNFCKLCL 335 >08_02_1103 - 24329120-24329623 Length = 167 Score = 32.7 bits (71), Expect = 0.28 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = +1 Query: 370 CAICRETFIDPKVLN---CFHTFCRACLDREQTHPDRVTCVTCR 492 C +C F V+N C H F RACL++ + D TC CR Sbjct: 100 CRVCLARFEPESVVNRLPCGHLFHRACLEKWLDY-DHATCPLCR 142 >08_01_0413 - 3679887-3681254 Length = 455 Score = 32.7 bits (71), Expect = 0.28 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDR-EQTHPDRVTCVTCR 492 C IC E+ DP V C H FC C+ + H + C C+ Sbjct: 241 CNICFESAKDPVVTPCGHLFCWPCIYQWLHGHSEHSDCPVCK 282 >05_03_0471 - 14455543-14455650,14455925-14456002,14456121-14456285, 14457151-14457261,14457863-14458024,14458462-14458538, 14459526-14460177 Length = 450 Score = 32.7 bits (71), Expect = 0.28 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACL 444 CAIC+E P +L C H FC C+ Sbjct: 423 CAICQEKMHVPVLLRCKHIFCEDCV 447 >04_04_0717 - 27525117-27525248,27525384-27525549,27525629-27525831, 27525911-27526048,27526642-27526725,27526864-27526950, 27527048-27527120,27527169-27527432,27527692-27527768, 27527886-27527957,27528049-27528209,27528238-27528484, 27528588-27528707,27528846-27528929,27529205-27529341, 27529689-27529856,27530093-27530317,27530865-27530952, 27531033-27531194,27532797-27532919 Length = 936 Score = 32.7 bits (71), Expect = 0.28 Identities = 12/51 (23%), Positives = 26/51 (50%) Frame = +1 Query: 337 DLRDFDGLDTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTCVTC 489 +++++ G+ C IC + + + C+H FC C+ + + R C +C Sbjct: 874 EVKEYRGI-LKCGICHDRQKEVVITKCYHLFCNQCIQKSLGNRQR-RCPSC 922 >02_03_0412 - 18749430-18749587,18749696-18749857,18750062-18750194, 18751640-18751744,18751818-18751935,18752232-18752320, 18752407-18753660,18753785-18753831,18754285-18754339, 18754783-18754884 Length = 740 Score = 32.7 bits (71), Expect = 0.28 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +1 Query: 322 DSAVCDLRDFDGLDTTCAICRETFIDPKVLNCFHTFCRACLDR 450 + VC +R + + C IC E+ + P++ +C H +C C+ R Sbjct: 217 EDIVC-VRYYSPCEVQCPICLESPLCPQITSCGHIYCFPCILR 258 >05_05_0173 + 22956927-22958615 Length = 562 Score = 32.3 bits (70), Expect = 0.36 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDR-EQTHPDRVTCVTCR 492 C IC E +P V +C H FC CL + H C C+ Sbjct: 238 CNICFEMASEPVVTSCGHLFCWPCLYQWLHVHSTHKECPVCK 279 >01_06_1819 + 40110697-40110721,40110818-40110828,40111228-40111572, 40111707-40111782,40113605-40113771,40113818-40114036 Length = 280 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTCVTCR 492 C +C ++P C H FC+ C+ + + + C TCR Sbjct: 225 CPVCMNELVEPSSTICGHIFCKQCI--KASIQAQKKCPTCR 263 >01_06_0829 - 32270189-32270863 Length = 224 Score = 31.9 bits (69), Expect = 0.48 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACL-DREQTHPDRVTCVTCR 492 C IC E DP V C H FC CL + H C C+ Sbjct: 27 CNICLELAQDPVVTLCGHLFCWPCLYEWLHVHAHSRECPVCK 68 >08_02_1143 + 24659105-24659386,24660171-24660272,24661259-24661521, 24661775-24661874,24662080-24662238,24662327-24663147, 24663299-24663618,24665831-24667398 Length = 1204 Score = 31.5 bits (68), Expect = 0.64 Identities = 21/67 (31%), Positives = 38/67 (56%) Frame = +1 Query: 226 SLESLPGANSIGSLERGSISPLTLSGSSPPASDSAVCDLRDFDGLDTTCAICRETFIDPK 405 +L++LP ++S+ S ++SP L SS A+ + DLR + C+ +E F DP Sbjct: 518 TLQALPASSSLISSNTENLSPQALPTSSESAAGVTIDDLR------SLCS--QEFFTDPV 569 Query: 406 VLNCFHT 426 V++ F++ Sbjct: 570 VVHAFNS 576 >05_04_0190 - 18922555-18923349 Length = 264 Score = 31.5 bits (68), Expect = 0.64 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 6/66 (9%) Frame = +1 Query: 370 CAICRETFID----PKVLNCFHTFCRACLDREQTHPDR--VTCVTCRVDTQLPPGGVDSL 531 C++C + + P +L+C H FCRACL R + + C CR T + V +L Sbjct: 6 CSLCHVRYDEEERAPLLLHCGHGFCRACLARMLANAAGAVLACPRCRHPTAV-GNSVSAL 64 Query: 532 LTNLVI 549 N I Sbjct: 65 RKNFPI 70 >03_02_0915 + 12360079-12360095,12360225-12361353 Length = 381 Score = 31.5 bits (68), Expect = 0.64 Identities = 27/108 (25%), Positives = 42/108 (38%), Gaps = 6/108 (5%) Frame = +1 Query: 313 PASDSAVCDLRDFDGL---DTTCAICRETFIDPKVLN--CFHTFCRACLDREQTHPDRVT 477 PAS A + + G+ + C ICR + + + CF +FC C+ R Sbjct: 152 PASSPAPAESGESGGVIPAELYCKICRNVMANAVLASKCCFDSFCDRCIRDHIAAKSRCA 211 Query: 478 C-VTCRVDTQLPPGGVDSLLTNLVIAAAVDQDAELLSSGRQTSSPLGS 618 C R +P + + + NL +A A S +T S GS Sbjct: 212 CGAQARAGDLIPNTTLRTTIANL-LATTTGAAASASSGTDKTRSSAGS 258 >07_03_1696 - 28779455-28779733,28779813-28780074,28780805-28780956, 28781765-28781961,28782258-28782462,28782737-28782982, 28783603-28783719,28784206-28784397,28784480-28784693, 28784835-28784926,28784952-28785001,28785494-28785812, 28785908-28786068,28786407-28786650,28787212-28787467, 28787634-28787834,28788568-28788910,28789003-28789064, 28789645-28789851,28790170-28790978 Length = 1535 Score = 31.1 bits (67), Expect = 0.84 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 9/61 (14%) Frame = +1 Query: 352 DGLDTTCAICRETFIDPK-VLNCFH-TFCRACL---DREQTHPDR----VTCVTCRVDTQ 504 D ++ C IC+E D K V C H C+ CL ++ H R + C TCR T Sbjct: 1210 DIINEPCPICQEKIFDQKMVFQCGHFVCCKCCLYMTEQAAAHFGRSKKWIMCPTCRQRTD 1269 Query: 505 L 507 L Sbjct: 1270 L 1270 >03_05_0500 + 24942047-24942541 Length = 164 Score = 31.1 bits (67), Expect = 0.84 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 4/107 (3%) Frame = +1 Query: 205 KMASRTPSLESLPGANSIGSLERGSISPLTLSGSSPPASDSAVCDLRDFDGLDTTCAICR 384 + A+R +E GA ++ + E+ + + + SS A+ +A + G D CA C+ Sbjct: 37 RAAARVDDVERALGAATLMTYEQAAAAAAKKASSSSRAAAAA-----EEQGEDR-CAYCQ 90 Query: 385 ETFI---DPKVLNCFHTFCRACLDREQTHPDRVTCVTCRVD-TQLPP 513 + + +V+ C H F C+DR R C CR + LPP Sbjct: 91 SEYAGADEVRVVQCGHFFHAGCIDRWLRKHRR--CPLCRGGLSPLPP 135 >07_03_1730 - 29099262-29099807 Length = 181 Score = 30.7 bits (66), Expect = 1.1 Identities = 26/70 (37%), Positives = 31/70 (44%), Gaps = 5/70 (7%) Frame = +1 Query: 298 SGSSPPASDSAVCDLRDFDGLDTTCAICR---ETFIDPKVLNCFHTFCRACLDR--EQTH 462 S SS PA+ +A D G CA+C E + + L C H F R CLDR Sbjct: 78 SESSRPAAAAA-----DDGGRPDQCAVCLSGIEEGDEVRELRCRHLFHRGCLDRWWLSAR 132 Query: 463 PDRVTCVTCR 492 P TC CR Sbjct: 133 PP-ATCPLCR 141 >05_05_0352 + 24328117-24328303,24328451-24328559,24330634-24330692, 24331139-24331220,24331361-24331481,24331751-24332278, 24332724-24332831,24332934-24333131,24334043-24334234, 24336116-24336199,24336385-24336525,24336683-24336748, 24336880-24337047,24337134-24337463,24337568-24337666 Length = 823 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +1 Query: 361 DTTCAICRETFIDPK-VLNCFHTFCRACLDREQTHPDRVTCVTCR 492 + C IC + V+ C H FCR C+D+ + C CR Sbjct: 111 EVQCPICLGIIRKTRTVMECLHRFCRDCIDKSMRLGNN-ECPACR 154 >03_03_0152 + 14908778-14909344 Length = 188 Score = 30.7 bits (66), Expect = 1.1 Identities = 26/76 (34%), Positives = 33/76 (43%), Gaps = 12/76 (15%) Frame = +1 Query: 301 GSSPPASDSAVCDLR----DFDGLDTTCAICRETFIDP-------KVLNCFHTFCRACLD 447 G PASD A+ L+ D D L CAIC +D K + C H F CL+ Sbjct: 40 GGVAPASDEAIEALKDVTGDIDQLPAECAICLHGGLDAAAAPAGWKEMPCGHRFHGGCLE 99 Query: 448 R-EQTHPDRVTCVTCR 492 + + H TC CR Sbjct: 100 KWLRAHG---TCPMCR 112 >01_06_1007 - 33733500-33733604,33733837-33733917,33734191-33734238, 33734364-33734549,33735148-33735678,33735823-33735864, 33735945-33736065,33736200-33736281,33737169-33737227, 33738492-33738564,33738694-33738913 Length = 515 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +1 Query: 361 DTTCAICRETFIDPK-VLNCFHTFCRACLDREQTHPDRVTCVTCR 492 + C IC + V+ C H FCR C+D+ + C CR Sbjct: 110 EVQCPICLGIIRKTRTVMECLHRFCRDCIDKSMRLGNN-ECPACR 153 >01_01_0797 - 6198401-6199114 Length = 237 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/60 (28%), Positives = 25/60 (41%), Gaps = 4/60 (6%) Frame = +1 Query: 370 CAICRETFIDPKVL----NCFHTFCRACLDREQTHPDRVTCVTCRVDTQLPPGGVDSLLT 537 CA+C D + + NC H F C+D R TC CR + ++P + T Sbjct: 129 CAVCLSELADGEKVRELPNCRHVFHVECVDAWLR--SRTTCPLCRAEAEVPKARASAAAT 186 >09_04_0233 - 15890085-15890234,15890345-15890551,15891112-15891356, 15891618-15891831,15892890-15893036 Length = 320 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = +1 Query: 355 GLDTTCAICRET-FIDPKV--LNCFHTFCRACLDREQTHPDRVTCVTCR 492 G +T CA+CRE+ +D K+ L C H F CL + + +C CR Sbjct: 235 GKETQCAVCRESLLVDDKMQELPCKHLFHPPCL--KPWLDENNSCPICR 281 >02_05_0890 - 32546918-32547088,32547224-32547334,32547705-32547884, 32547960-32548064,32548333-32548431,32548524-32548679, 32548772-32548850,32549213-32549278,32549382-32549536, 32549675-32550034,32550150-32550305,32550779-32550856, 32551471-32551812 Length = 685 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTC 480 D C IC D + C H+FC C+ +H C Sbjct: 57 DLLCPICMAVIKDAFLTACGHSFCYMCIVTHLSHKSDCPC 96 >03_01_0627 - 4598655-4599716 Length = 353 Score = 29.9 bits (64), Expect = 1.9 Identities = 18/52 (34%), Positives = 21/52 (40%), Gaps = 4/52 (7%) Frame = +1 Query: 370 CAICRETFIDPKVLN----CFHTFCRACLDREQTHPDRVTCVTCRVDTQLPP 513 CA+C F D L C H F C+D VTC CR + PP Sbjct: 133 CAVCLAEFADSDELRVLPACCHVFHPDCIDPWLAAA--VTCPLCRANLTAPP 182 >10_08_0961 + 21869612-21869773,21869869-21869956,21870047-21870277, 21870371-21870538,21870808-21871001,21871151-21871234, 21871315-21871434,21871621-21871714,21871813-21871973, 21873237-21873313,21873738-21873932,21874487-21874559, 21874635-21874721,21874906-21875043,21875181-21875383, 21875469-21875631,21875861-21875992 Length = 789 Score = 29.5 bits (63), Expect = 2.6 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDR 450 C +C + + + CFH FC C+ R Sbjct: 737 CGVCFDRPKEVVITKCFHLFCSPCIQR 763 >03_05_0677 + 26663880-26664581 Length = 233 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +1 Query: 346 DFDGLDTTCAICRETFIDPKVLNCFHTFCRACLDR-EQTHPDRVTCVTCR 492 D G C IC E +P V C H FC C+ R H C C+ Sbjct: 16 DAAGGSFECNICFELPQEPIVTLCGHLFCWPCIYRWLHIHAHSPECPVCK 65 >01_06_1224 - 35508842-35510404 Length = 520 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDR-EQTHPDRVTCVTCR 492 C IC + +P V +C H FC CL + + + C C+ Sbjct: 194 CNICFDMASEPVVTSCGHLFCWPCLYQWLNVYSNHKECPVCK 235 >12_02_1243 + 27300978-27301682 Length = 234 Score = 29.1 bits (62), Expect = 3.4 Identities = 21/65 (32%), Positives = 24/65 (36%), Gaps = 1/65 (1%) Frame = +1 Query: 301 GSSPPASDSAVCDLRDFDGLDTTCAICRETFIDPKVLNCFHTFCRACLDR-EQTHPDRVT 477 G S S S D G C IC E +P V C H FC CL + H Sbjct: 6 GESTSGSSSGGAD----SGGSFECNICFELPQEPIVTLCGHLFCWPCLYKWLHIHSHSPE 61 Query: 478 CVTCR 492 C C+ Sbjct: 62 CPVCK 66 >09_06_0247 + 21844311-21845646,21845991-21846118 Length = 487 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 275 APYRPSLSAVHHPLRATPPYVIYATSTDSIPLAPSAVRHSS 397 A RPSL +H+P PY Y D++ + P RH++ Sbjct: 121 ASSRPSLKLIHNPYNPYNPY-HYLRRIDNVVVLPDRRRHAA 160 >09_04_0651 - 19224403-19225032 Length = 209 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 355 GLDTTCAICRETFIDPKVLNCFHTFCRAC 441 G+ C +C + C HTFCRAC Sbjct: 156 GVGGRCCVCMARGKAAAFIPCGHTFCRAC 184 >07_03_1304 - 25629822-25629839,25630091-25631148,25631784-25634928, 25635454-25636293 Length = 1686 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +1 Query: 358 LDTTCAICRETFIDP-KVLNCFHTFCRACL 444 L+ C IC DP K+ +C H FC CL Sbjct: 1520 LENACPICLCEVEDPFKLESCGHVFCLTCL 1549 >03_04_0142 - 17656751-17657554 Length = 267 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 4/45 (8%) Frame = +1 Query: 322 DSAVCDLRDFDGLDTTCAICRETF--ID--PKVLNCFHTFCRACL 444 +++ C R+ +GL+ C IC E+F ++ P VL C HT C+ C+ Sbjct: 32 EASSCTSRE-EGLE--CPICWESFNIVENVPYVLWCGHTMCKNCI 73 >12_01_0052 + 433203-433292,433409-433815,434435-434447,437081-437473 Length = 300 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -2 Query: 289 GAIWSHAPANLLSWHRAATQGTGCVRPSSGNRHP 188 G +W HA + SW RA G +RP G +P Sbjct: 120 GTLWWHAHS---SWLRATVYGALLIRPRDGTSYP 150 >11_01_0051 + 391254-391343,391460-391862,392345-392352,393627-393704, 395371-395763 Length = 323 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -2 Query: 289 GAIWSHAPANLLSWHRAATQGTGCVRPSSGNRHP 188 G +W HA + SW RA G +RP G +P Sbjct: 120 GTLWWHAHS---SWLRATVYGALLIRPRDGTSYP 150 >07_03_0535 - 19198130-19198139,19199901-19199995,19200095-19200154, 19200241-19200349,19200438-19200604,19200694-19200813, 19200901-19200987,19201068-19201196,19201284-19201362, 19201451-19201530,19201646-19201726,19201812-19201874, 19201963-19202139,19202381-19202476,19202610-19202729, 19202825-19202933,19203016-19203235,19203320-19203405, 19203491-19203552,19203649-19203685,19203790-19203848, 19203952-19204037,19204142-19204313 Length = 767 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 208 MASRTPSLESLPGANSIGSLERGSISPLTLSGSSPPASDSAV 333 M T ++ A+S+G++ S PLTL+ PP ++A+ Sbjct: 436 MERATRHADTCSEASSVGTIRSQSSKPLTLTAPKPPQLETAL 477 >04_04_0905 - 29290998-29291486 Length = 162 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/50 (36%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Frame = +1 Query: 355 GLDTTCAICRETF--IDP--KVLNCFHTFCRACLDREQTHPDRVTCVTCR 492 G TC +C E D ++ NC H F C+DR VTC CR Sbjct: 96 GYPATCRVCLERLEATDEVRRLGNCTHAFHIGCIDR-WIDLGEVTCPLCR 144 >03_01_0471 + 3629158-3629185,3630027-3630058,3630272-3630344, 3630745-3630969,3631319-3631789,3632286-3633118 Length = 553 Score = 28.7 bits (61), Expect = 4.5 Identities = 30/99 (30%), Positives = 37/99 (37%), Gaps = 5/99 (5%) Frame = +1 Query: 370 CAICRETF-IDPK--VLNCFHTFCRACLDREQTHPDRVTCVTCRVD--TQLPPGGVDSLL 534 CAIC E + + K VL C H F AC+D T R C C+ D T +P Sbjct: 256 CAICLEDYNVGEKLRVLPCRHKFHAACVDLWLT-TWRTFCPVCKRDASTGIPDPPASETT 314 Query: 535 TNLVIAAAVDQDAELLSSGRQTSSPLGSLHRLQVQGI*R 651 L A + + S S P R Q I R Sbjct: 315 PLLSSAVRLPSQSSSFRSSVAASPPRPISRRPSSQSISR 353 >07_03_1459 + 26681619-26682419,26682600-26682912,26683861-26684672 Length = 641 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +1 Query: 352 DGLDTTCAICRETFIDPKVLNCFHTFCRACL 444 DG D C IC + +C H +C+ C+ Sbjct: 389 DGDDFECPICLAPPAKTVITSCTHIYCQTCI 419 >04_04_1247 - 32043776-32043880,32044296-32044505,32044595-32045101, 32045362-32045583,32046054-32046184,32046737-32047745, 32047830-32047904,32047995-32048066,32048153-32048328, 32048494-32048646,32048739-32049234 Length = 1051 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = +1 Query: 340 LRDFDGLDTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPDRV 474 L +G C+ C + D V C H FC C+ + T + V Sbjct: 764 LGQLEGDYAICSRCSDPPEDVVVATCGHVFCYQCVHKSLTSDENV 808 >03_02_0670 - 10303538-10303930,10304349-10305444,10305831-10306228 Length = 628 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 226 SLESLPGANSIGSLERGSISPLTLSGSSP 312 S+E +PG+N G G++ LT + S+P Sbjct: 163 SIEEVPGSNGRGGANEGTVFQLTFACSAP 191 >01_06_0715 + 31416338-31416500,31416601-31416710,31416808-31416880, 31416988-31417135,31417867-31418133,31418234-31418576, 31418665-31418802,31419389-31419514,31419626-31419838, 31419918-31420164,31420247-31420446,31420538-31420891, 31420984-31421568 Length = 988 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 415 CFHTFCRACLDREQTHPDRVTCVTC 489 C + C+ACLD E R TC C Sbjct: 22 CSYALCKACLD-EDAAEGRTTCARC 45 >01_01_0145 + 1327172-1327362,1327491-1328169 Length = 289 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -1 Query: 632 CSRCNEPKGELVCRPDE 582 C CNEP G++ CRP E Sbjct: 84 CPSCNEPIGDIRCRPLE 100 >12_02_1214 - 27061794-27062178,27063018-27063766,27064427-27064831 Length = 512 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = +1 Query: 367 TCAICRETFIDPKVLN--CFHTFCRACL 444 TC+IC E +++ C HTFC +CL Sbjct: 197 TCSICCEEKRGAQMIKVGCAHTFCYSCL 224 >12_02_0132 - 14054331-14054969 Length = 212 Score = 27.9 bits (59), Expect = 7.8 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +1 Query: 415 CFHTFCRACLDRE-QTHPDRVTCVTCRVDTQLPPGG 519 C H F AC+D + H TC CR D ++ GG Sbjct: 174 CGHAFHAACIDGWLRAH---ATCPVCRADVKVAAGG 206 >11_06_0155 - 20712601-20713553,20713618-20714000,20714240-20714271, 20714315-20714571,20714699-20714724,20714894-20715081, 20715302-20715595,20715714-20715752,20715827-20715944, 20716076-20716157,20716610-20716668,20717156-20717221, 20717358-20717447,20718142-20718236 Length = 893 Score = 27.9 bits (59), Expect = 7.8 Identities = 20/86 (23%), Positives = 36/86 (41%), Gaps = 6/86 (6%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLN-CFHTFCRACLDREQTHPDRVTCVTCRV-----DTQLPPGGV 522 + C IC +++ C H FCR C+++ + C CR ++ P Sbjct: 96 EVQCPICLGIIQKARIITECLHRFCRDCIEKSMWLGND-ECPACRTLASSHSLKVDP-NF 153 Query: 523 DSLLTNLVIAAAVDQDAELLSSGRQT 600 D+L+ L D++ EL + +T Sbjct: 154 DALILTLYPDLHKDEEEELAFTEEKT 179 >10_08_0150 + 15227739-15228140 Length = 133 Score = 27.9 bits (59), Expect = 7.8 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +1 Query: 370 CAICRETFIDPKV---LNCFHTFCRACLDR-EQTHPDRVTCVTCRV 495 C +C F D + L C H F R C+DR + R TC CR+ Sbjct: 53 CCVCISGFRDGEEVRRLPCGHAFHRDCVDRWLALYCRRRTCPLCRL 98 >08_01_0376 - 3320621-3321151 Length = 176 Score = 27.9 bits (59), Expect = 7.8 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 412 NCFHTFCRACLDREQTHPDRVTCVTCR 492 NC H F +AC+D+ + TC CR Sbjct: 125 NCAHAFHKACIDK-WVDKGQATCPLCR 150 >04_03_0747 - 19251617-19251781,19252377-19252502,19252606-19252716, 19252931-19253679,19254034-19254167,19254595-19254740, 19255166-19255336,19255977-19256828 Length = 817 Score = 27.9 bits (59), Expect = 7.8 Identities = 21/64 (32%), Positives = 27/64 (42%) Frame = +2 Query: 212 PHAPRPLSRCPVPTQ*VRWSVAPYRPSLSAVHHPLRATPPYVIYATSTDSIPLAPSAVRH 391 P P P +R P+PT + P RP + PL A P T T S P +A Sbjct: 129 PPPPPPPARTPMPTPTPTPTPTPTRPPVPVWAAPLPARTP-----TPTPSAPPRAAAPSP 183 Query: 392 SSTP 403 + TP Sbjct: 184 AGTP 187 >03_05_0377 + 23613181-23613342,23614469-23614501,23614606-23614879, 23615105-23615585,23616174-23616846 Length = 540 Score = 27.9 bits (59), Expect = 7.8 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = +1 Query: 367 TCAICRETF--IDPKVLNCFHTFCRAC 441 TC +C E F D ++C H FC C Sbjct: 131 TCNVCFEDFSMTDVSTMDCGHCFCNDC 157 >02_05_0391 + 28563242-28563302,28563714-28563931,28564563-28564637, 28564730-28565264,28565343-28565523,28565586-28565724, 28565826-28566067,28566157-28566322,28566591-28566698 Length = 574 Score = 27.9 bits (59), Expect = 7.8 Identities = 25/77 (32%), Positives = 35/77 (45%), Gaps = 3/77 (3%) Frame = +1 Query: 265 LERGSISPLTLSGSS--PPASDSAVCDLRDFDGLDTTC-AICRETFIDPKVLNCFHTFCR 435 ++ GS++ LT +S P + + L DG C A C D + CF TFC Sbjct: 322 VKEGSVARLTCPDTSCRRPLPPALLRGLLG-DGEYARCSAACVAAGDDAQCSRCFFTFCA 380 Query: 436 ACLDREQTHPDRVTCVT 486 C RE+ H TCV+ Sbjct: 381 VC--RERRHVGD-TCVS 394 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,945,090 Number of Sequences: 37544 Number of extensions: 415947 Number of successful extensions: 1445 Number of sequences better than 10.0: 73 Number of HSP's better than 10.0 without gapping: 1388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1443 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1714968940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -