BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0616 (674 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 66 2e-11 SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 66 2e-11 SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 66 2e-11 SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) 66 3e-11 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) 64 7e-11 SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) 64 1e-10 SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 64 1e-10 SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_24396| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) 62 4e-10 SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) 62 5e-10 SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) 61 9e-10 SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) 60 1e-09 SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) 60 2e-09 SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) 59 4e-09 SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) 58 6e-09 SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) 58 6e-09 SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 57 1e-08 SB_15975| Best HMM Match : NHL (HMM E-Value=5e-09) 57 1e-08 SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) 56 2e-08 SB_18584| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) 55 5e-08 SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 55 6e-08 SB_36856| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-05) 54 1e-07 SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 54 1e-07 SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 54 1e-07 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 52 3e-07 SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 52 3e-07 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) 52 6e-07 SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_36857| Best HMM Match : zf-C3HC4 (HMM E-Value=2.8e-05) 52 6e-07 SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) 51 1e-06 SB_23995| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-05) 50 1e-06 SB_10859| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_3354| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) 45 5e-05 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 45 6e-05 SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) 45 6e-05 SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_20928| Best HMM Match : NHL (HMM E-Value=0) 44 1e-04 SB_14351| Best HMM Match : zf-B_box (HMM E-Value=2.3e-12) 44 1e-04 SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) 44 1e-04 SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) 44 1e-04 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 42 5e-04 SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) 42 5e-04 SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 42 5e-04 SB_33464| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0019) 42 6e-04 SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) 41 0.001 SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) 40 0.001 SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) 40 0.001 SB_47830| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_15354| Best HMM Match : NHL (HMM E-Value=4.4e-14) 38 0.006 SB_29658| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0012) 38 0.007 SB_8285| Best HMM Match : Filamin (HMM E-Value=1.1e-09) 38 0.007 SB_4351| Best HMM Match : zf-B_box (HMM E-Value=1.3e-25) 38 0.007 SB_49217| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_31924| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00073) 38 0.010 SB_45821| Best HMM Match : zf-B_box (HMM E-Value=1.1e-12) 37 0.013 SB_32308| Best HMM Match : MIF4G (HMM E-Value=1.5e-17) 37 0.013 SB_31116| Best HMM Match : zf-C3HC4 (HMM E-Value=5.6e-10) 36 0.023 SB_14207| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0048) 36 0.023 SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.023 SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) 36 0.023 SB_58465| Best HMM Match : zf-B_box (HMM E-Value=0.00022) 34 0.12 SB_30622| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-14) 34 0.12 SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 33 0.16 SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) 33 0.16 SB_12693| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0014) 33 0.16 SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 33 0.21 SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 33 0.21 SB_1298| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 33 0.28 SB_41147| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_18583| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 31 0.85 SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) 31 0.85 SB_19621| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_52170| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) 31 1.1 SB_24433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) 31 1.1 SB_59800| Best HMM Match : SPRY (HMM E-Value=7.8e-05) 30 1.5 SB_45256| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_33756| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0035) 30 1.5 SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) 30 2.0 SB_56584| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) 29 2.6 SB_49784| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_44886| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) 29 2.6 SB_38758| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_20851| Best HMM Match : Cbl_N3 (HMM E-Value=0) 29 3.4 SB_51713| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_37498| Best HMM Match : MATH (HMM E-Value=1.8e-28) 29 3.4 SB_25082| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_698| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00037) 29 4.5 SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) 28 6.0 SB_43998| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_41628| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_106| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_47760| Best HMM Match : DUF1168 (HMM E-Value=2.1) 28 7.9 SB_4531| Best HMM Match : zf-C3HC4 (HMM E-Value=0.098) 28 7.9 SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) 28 7.9 >SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 442 Score = 66.1 bits (154), Expect = 2e-11 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 3/70 (4%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPD---RVTCVTCRVDTQLPPGGVDSL 531 + TC+IC E F DP+VL CFH+FCR CL+ H + ++ C C+ + Q+ P V SL Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPADVPSL 71 Query: 532 LTNLVIAAAV 561 N +I + + Sbjct: 72 KVNFMINSII 81 >SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 291 Score = 66.1 bits (154), Expect = 2e-11 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 3/70 (4%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPD---RVTCVTCRVDTQLPPGGVDSL 531 + TC+IC E F DP+VL CFH+FCR CL+ H + ++ C C+ + Q+ P V SL Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPADVPSL 71 Query: 532 LTNLVIAAAV 561 N +I + + Sbjct: 72 KVNFMINSII 81 >SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 745 Score = 66.1 bits (154), Expect = 2e-11 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 3/70 (4%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPD---RVTCVTCRVDTQLPPGGVDSL 531 + TC+IC E F DP+VL CFH+FCR CL+ H + ++ C C+ + Q+ P V SL Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPADVPSL 71 Query: 532 LTNLVIAAAV 561 N +I + + Sbjct: 72 KVNFMINSII 81 >SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) Length = 405 Score = 65.7 bits (153), Expect = 3e-11 Identities = 28/66 (42%), Positives = 40/66 (60%), Gaps = 3/66 (4%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPD---RVTCVTCRVDTQLPPGGVDSL 531 + TC+IC E F DP+VL CFH+FCR CL+ H + ++ C C+ + Q+ P V SL Sbjct: 11 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPADVPSL 70 Query: 532 LTNLVI 549 N +I Sbjct: 71 KVNFMI 76 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 64.9 bits (151), Expect = 6e-11 Identities = 27/66 (40%), Positives = 40/66 (60%), Gaps = 3/66 (4%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPD---RVTCVTCRVDTQLPPGGVDSL 531 + TC++C E F DP+VL CFH+FCR CL+ H + ++ C C+ + Q+ P V SL Sbjct: 12 EVTCSLCIEHFNDPRVLPCFHSFCRHCLEELAVHSEGKGKLVCPLCKAEFQISPADVPSL 71 Query: 532 LTNLVI 549 N +I Sbjct: 72 KVNFMI 77 >SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) Length = 355 Score = 64.5 bits (150), Expect = 7e-11 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 3/73 (4%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPD---RVTCVTCRVDTQLPPGGVDSL 531 + C+IC E F DP+VL CFH+FCR CL+ H + ++ C C+ + Q+ P V SL Sbjct: 12 EVRCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPADVPSL 71 Query: 532 LTNLVIAAAVDQD 570 N +I + D Sbjct: 72 KVNFMILPLLTSD 84 >SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 667 Score = 64.1 bits (149), Expect = 1e-10 Identities = 27/70 (38%), Positives = 41/70 (58%), Gaps = 3/70 (4%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPD---RVTCVTCRVDTQLPPGGVDSL 531 + TC+IC E F DP+VL C H+FCR CL+ H + ++ C C+ + Q+ P V SL Sbjct: 17 EVTCSICIEHFDDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPADVSSL 76 Query: 532 LTNLVIAAAV 561 N +I + + Sbjct: 77 KVNFMINSII 86 >SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) Length = 463 Score = 64.1 bits (149), Expect = 1e-10 Identities = 27/70 (38%), Positives = 41/70 (58%), Gaps = 3/70 (4%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPD---RVTCVTCRVDTQLPPGGVDSL 531 + TC+IC E F DP+VL C H+FCR CL+ H + ++ C C+ + Q+ P V SL Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPADVSSL 71 Query: 532 LTNLVIAAAV 561 N +I + + Sbjct: 72 KVNFMINSII 81 >SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 119 Score = 63.7 bits (148), Expect = 1e-10 Identities = 27/70 (38%), Positives = 41/70 (58%), Gaps = 3/70 (4%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPD---RVTCVTCRVDTQLPPGGVDSL 531 + TC+IC E F DP+VL C H+FCR CL+ H + ++ C C+ + Q+ P V SL Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPADVPSL 71 Query: 532 LTNLVIAAAV 561 N +I + + Sbjct: 72 KVNFMINSII 81 >SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 63.3 bits (147), Expect = 2e-10 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 3/70 (4%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPD---RVTCVTCRVDTQLPPGGVDSL 531 + TC++C E F DP+VL C H+FCR CL+ H + ++ C C+ + Q+ P V SL Sbjct: 12 EVTCSLCIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPADVSSL 71 Query: 532 LTNLVIAAAV 561 N +I + + Sbjct: 72 KVNFMINSII 81 >SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 63.3 bits (147), Expect = 2e-10 Identities = 30/87 (34%), Positives = 47/87 (54%), Gaps = 3/87 (3%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPD---RVTCVTCRVDTQLPPGGVDSL 531 + TC++C E F DP+VL C H+FCR CL+ H + ++ C C+ + Q+ P V SL Sbjct: 12 EVTCSLCIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPADVPSL 71 Query: 532 LTNLVIAAAVDQDAELLSSGRQTSSPL 612 N +I + + LL+S P+ Sbjct: 72 KVNFMINSIISV-LPLLTSEDSKKKPV 97 >SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 62.9 bits (146), Expect = 2e-10 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 1/76 (1%) Frame = +1 Query: 325 SAVCDLRDFDGLDTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPDRV-TCVTCRVDT 501 SAV R D C IC+ET+ +PKVL C H+FC+ CLD+ +RV C TC+ Sbjct: 2 SAVLVNRIQDHYRLVCGICQETYNNPKVLPCLHSFCQNCLDKSIRSQERVLVCPTCQCSV 61 Query: 502 QLPPGGVDSLLTNLVI 549 +P G+++ N I Sbjct: 62 PVPAKGIEAFPVNFFI 77 >SB_24396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 62.5 bits (145), Expect = 3e-10 Identities = 27/69 (39%), Positives = 40/69 (57%), Gaps = 3/69 (4%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACL---DREQTHPDRVTCVTCRVDTQLPPGGVDSLLTN 540 C C + F +PK+L+C HTFC+ CL D + + C CR T +P GV+SL +N Sbjct: 16 CRACHKVFTEPKILDCLHTFCQKCLGTHDILGAGTNSIVCPLCRKPTPIPESGVESLPSN 75 Query: 541 LVIAAAVDQ 567 ++ A+DQ Sbjct: 76 FLLNNALDQ 84 >SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) Length = 455 Score = 62.1 bits (144), Expect = 4e-10 Identities = 27/70 (38%), Positives = 41/70 (58%), Gaps = 3/70 (4%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPD---RVTCVTCRVDTQLPPGGVDSL 531 + TC+IC E F DP+VL CFH+FC CL+ H + ++ C C+ + Q+ P V SL Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCLHCLEELAVHSEGRGKLVCPLCKAEFQISPADVLSL 71 Query: 532 LTNLVIAAAV 561 N +I + + Sbjct: 72 KVNFMINSII 81 >SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) Length = 629 Score = 61.7 bits (143), Expect = 5e-10 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 3/66 (4%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPD---RVTCVTCRVDTQLPPGGVDSL 531 + TC++C E F DP+VL C H+FCR CL+ H + ++ C C+ + Q+ P V SL Sbjct: 132 EVTCSLCIEHFNDPRVLPCLHSFCRHCLEELAVHSEGKGKLVCPLCKSEFQISPADVPSL 191 Query: 532 LTNLVI 549 N +I Sbjct: 192 KVNFMI 197 >SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) Length = 316 Score = 60.9 bits (141), Expect = 9e-10 Identities = 26/66 (39%), Positives = 38/66 (57%), Gaps = 3/66 (4%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPD---RVTCVTCRVDTQLPPGGVDSL 531 + TC+IC E DP+VL C H+FCR CL+ H + ++ C C+ + Q+ P V SL Sbjct: 12 EVTCSICIEHLNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPADVPSL 71 Query: 532 LTNLVI 549 N +I Sbjct: 72 KVNFMI 77 >SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) Length = 645 Score = 60.5 bits (140), Expect = 1e-09 Identities = 32/91 (35%), Positives = 53/91 (58%), Gaps = 2/91 (2%) Frame = +1 Query: 298 SGSSPPASDSAVCDLRDFDGLDTTCAICRETFIDPKVLNCFHTFCRACLDR-EQTHPDRV 474 SGSS +S S++ +R+ + TC++C E F +PK+L CFHTFC+ CL++ +Q+ + Sbjct: 3 SGSSI-SSQSSIEKVRE----ELTCSVCLEQFREPKMLPCFHTFCKECLEKTKQSFRGNL 57 Query: 475 TCVTCRVDTQLPPGG-VDSLLTNLVIAAAVD 564 C TCR T + + L N ++ +D Sbjct: 58 LCPTCRTKTSVTEHEMIQKLPNNFIVNRVLD 88 >SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) Length = 470 Score = 60.1 bits (139), Expect = 2e-09 Identities = 26/65 (40%), Positives = 38/65 (58%), Gaps = 2/65 (3%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLD--REQTHPDRVTCVTCRVDTQLPPGGVDSLL 534 + TCAIC E F DP++L C HTFCR CL+ E + ++ C C+V+ ++ + SL Sbjct: 12 EVTCAICIEHFTDPRLLPCLHTFCRHCLEDLAEHSGKGKLVCPLCKVEYEIAVADIPSLK 71 Query: 535 TNLVI 549 N I Sbjct: 72 VNFPI 76 >SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) Length = 584 Score = 58.8 bits (136), Expect = 4e-09 Identities = 30/79 (37%), Positives = 43/79 (54%), Gaps = 7/79 (8%) Frame = +1 Query: 352 DGLDTTCAICRETFIDPKVLNCFHTFCRACLD--REQTHPDRVTCVTCRVDTQLPPGGV- 522 D D TC +C E + DP+VL C HT+CR CL+ E + D ++C CR Q+ V Sbjct: 10 DVKDVTCCLCLEQYQDPRVLACLHTYCRHCLESLAEHSQGDSISCPQCREKIQISVDKVQ 69 Query: 523 ----DSLLTNLVIAAAVDQ 567 D LL+NL+ ++ Q Sbjct: 70 NLKEDFLLSNLIKRISLSQ 88 >SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 549 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 2/70 (2%) Frame = +1 Query: 361 DTTCAICRETFIDPKVL-NCFHTFCRACLDREQTHPDR-VTCVTCRVDTQLPPGGVDSLL 534 + TC +C E +PK L +C H C+ CLDR + ++ + C TCR T +P GGV +L Sbjct: 14 ELTCPVCLEELKEPKCLTSCAHNVCKPCLDRMTFNGEKEIRCPTCRRSTLIPDGGVKALP 73 Query: 535 TNLVIAAAVD 564 TN ++ ++ Sbjct: 74 TNTILVRLLE 83 >SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) Length = 581 Score = 58.0 bits (134), Expect = 6e-09 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDR-EQTHPDRVTCVTCRVDTQLPPGGVDSLLTNLV 546 C +C E F +P++L C HTFC+ CL+ ++C +CR+D L G++ N V Sbjct: 145 CPLCHEMFANPRLLPCLHTFCKRCLENLVPPRSHTLSCPSCRLDVALGERGINGFAPNFV 204 Query: 547 IAAAVD 564 + +D Sbjct: 205 VTTMID 210 >SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) Length = 207 Score = 58.0 bits (134), Expect = 6e-09 Identities = 32/93 (34%), Positives = 47/93 (50%), Gaps = 3/93 (3%) Frame = +1 Query: 370 CAICRETFIDPKVLN-CFHTFCRACLDREQTHPDR-VTCVTCRVDTQLPPGGVDSLLTNL 543 C++C E F DP+ L C H+FC+ CL + + + + C CR T +P GV L N Sbjct: 68 CSVCYEVFSDPRTLTACLHSFCKECLHKMLSKRSKYIHCPLCRKKTAVPRRGVKGLPLNS 127 Query: 544 VIAAAVD-QDAELLSSGRQTSSPLGSLHRLQVQ 639 VI VD +E ++S R S H ++ Q Sbjct: 128 VIRRLVDVHSSEGMTSARHRKRHPVSTHMIEQQ 160 >SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 82 Score = 57.2 bits (132), Expect = 1e-08 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 7/64 (10%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPD---RVTCVTCRVDTQ--LP--PGG 519 + TC+IC E F DP+VL CFH+FCR CL+ H + ++ C C+ + Q LP PG Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQSALPALPGS 71 Query: 520 VDSL 531 D + Sbjct: 72 ADKM 75 >SB_15975| Best HMM Match : NHL (HMM E-Value=5e-09) Length = 589 Score = 56.8 bits (131), Expect = 1e-08 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 3/71 (4%) Frame = +1 Query: 361 DTTCAICRETFIDPKVL-NCFHTFCRACLDREQTHPD--RVTCVTCRVDTQLPPGGVDSL 531 + +C +C E F++PK L NC H CR CL+ T + + C CR ++ LP G++ L Sbjct: 20 ECSCPVCLEDFLEPKSLPNCAHNVCRKCLEGMATDSESKEIRCPVCRKESTLPEDGINGL 79 Query: 532 LTNLVIAAAVD 564 TN +I ++ Sbjct: 80 PTNCLIVKLLE 90 >SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 56.8 bits (131), Expect = 1e-08 Identities = 28/67 (41%), Positives = 36/67 (53%), Gaps = 2/67 (2%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACL-DREQTHPDRV-TCVTCRVDTQLPPGGVDSLLTNL 543 C IC + F +PK L+C H CR CL D RV C CR + +P GGV +L TNL Sbjct: 21 CPICLDEFKEPKTLSCMHDLCRKCLEDMAARESSRVIRCPLCRSEIDIPRGGVKNLPTNL 80 Query: 544 VIAAAVD 564 + V+ Sbjct: 81 RLMKLVE 87 >SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) Length = 594 Score = 56.4 bits (130), Expect = 2e-08 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 2/73 (2%) Frame = +1 Query: 352 DGLDTTCAICRETFIDPKVLNCFHTFCRACLDR--EQTHPDRVTCVTCRVDTQLPPGGVD 525 D D TC +C E + DP+VL C HT+CR CL+ E + V+C CR ++ V+ Sbjct: 10 DVKDVTCCLCLEQYQDPRVLACLHTYCRHCLESLVEHSKECTVSCPQCREKIEISVDEVE 69 Query: 526 SLLTNLVIAAAVD 564 L N ++ ++ Sbjct: 70 ELKVNFMLKDLIE 82 >SB_18584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1022 Score = 56.4 bits (130), Expect = 2e-08 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 1/65 (1%) Frame = +1 Query: 358 LDTTCAICRETFIDPKVLNCFHTFCRACLDREQT-HPDRVTCVTCRVDTQLPPGGVDSLL 534 + T C +CRET+ DP+V C H+FC+ C+ + T + C C+ D Q+ V++L Sbjct: 401 MSTICGVCRETYTDPRVAPCLHSFCKECVTKLVTERQGKFVCPDCQADFQMSVKDVENLS 460 Query: 535 TNLVI 549 N I Sbjct: 461 QNFSI 465 >SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) Length = 599 Score = 55.2 bits (127), Expect = 5e-08 Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 7/77 (9%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDR--EQTHPDRVTCVTCRVDTQLPPGGVDSL- 531 D TC++C E + DP+VL C HT+CR CL+ E + V+C CR ++ V SL Sbjct: 23 DVTCSLCLEQYQDPRVLACLHTYCRHCLESLVEHSKECTVSCPQCREKIEISVEEVKSLK 82 Query: 532 ----LTNLVIAAAVDQD 570 L +L+ +VDQ+ Sbjct: 83 VDFMLIDLIEKMSVDQE 99 >SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 89 Score = 54.8 bits (126), Expect = 6e-08 Identities = 22/51 (43%), Positives = 32/51 (62%), Gaps = 3/51 (5%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPD---RVTCVTCRVDTQ 504 + TC+IC E F DP+VL CFH+FCR CL+ H + ++ C C+ + Q Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQ 62 >SB_36856| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-05) Length = 406 Score = 53.6 bits (123), Expect = 1e-07 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 3/73 (4%) Frame = +1 Query: 355 GLDTTCAICRETFIDPKVL-NCFHTFCRACLDR--EQTHPDRVTCVTCRVDTQLPPGGVD 525 G + C +C E F++PK L +C H CR CL++ ++ V C CR +++P GV+ Sbjct: 17 GDEGACPVCIEVFVEPKSLPSCAHNVCRECLEKITKRNSIRFVECPICRARSEIPQNGVN 76 Query: 526 SLLTNLVIAAAVD 564 S TN ++ ++ Sbjct: 77 SFPTNTLLVRIIE 89 >SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 604 Score = 53.6 bits (123), Expect = 1e-07 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 7/80 (8%) Frame = +1 Query: 352 DGLDTTCAICRETFIDPKVLNCFHTFCRACLDR--EQTHPDRVTCVTCRVD-----TQLP 510 D D TC++C E + DP+VL C HT+CR CL+ E + V+C CR ++ Sbjct: 11 DVSDVTCSLCLEQYQDPRVLACLHTYCRHCLESLVEHSQERTVSCPQCREKIVISVEEVK 70 Query: 511 PGGVDSLLTNLVIAAAVDQD 570 VD +L +++ ++DQ+ Sbjct: 71 DLKVDFMLNDMIRKMSLDQE 90 >SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 462 Score = 53.6 bits (123), Expect = 1e-07 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 7/80 (8%) Frame = +1 Query: 352 DGLDTTCAICRETFIDPKVLNCFHTFCRACLDR--EQTHPDRVTCVTCRVD-----TQLP 510 D D TC++C E + DP+VL C HT+CR CL+ E + V+C CR ++ Sbjct: 11 DVSDVTCSLCLEQYQDPRVLACLHTYCRHCLESLVEHSQERTVSCPQCREKIVISVEEVK 70 Query: 511 PGGVDSLLTNLVIAAAVDQD 570 VD +L +++ ++DQ+ Sbjct: 71 DLKVDFMLNDMIKKMSLDQE 90 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 52.8 bits (121), Expect = 2e-07 Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 7/80 (8%) Frame = +1 Query: 352 DGLDTTCAICRETFIDPKVLNCFHTFCRACLDR--EQTHPDRVTCVTCRVDTQLPPGGVD 525 D D TC++C + DP+VL C HT+CR CL+ E + V+C CR ++ V Sbjct: 11 DVSDVTCSLCLGQYQDPRVLACLHTYCRHCLESLVEHSKECTVSCPQCREKIEISVEEVK 70 Query: 526 SL-----LTNLVIAAAVDQD 570 SL L +L+ +VDQ+ Sbjct: 71 SLKVDFMLIDLIEKMSVDQE 90 >SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 52.4 bits (120), Expect = 3e-07 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPD---RVTCVTCRVDTQ 504 + TC+IC E F DP+VL C H+FCR CL+ H + ++ C C+ + Q Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQ 62 >SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 52.4 bits (120), Expect = 3e-07 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPD---RVTCVTCRVDTQ 504 + TC+IC E F DP+VL C H+FCR CL+ H + ++ C C+ + Q Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQ 62 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 52.4 bits (120), Expect = 3e-07 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPD---RVTCVTCRVDTQ 504 + TC+IC E F DP+VL C H+FCR CL+ H + ++ C C+ + Q Sbjct: 11 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQ 61 >SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) Length = 691 Score = 51.6 bits (118), Expect = 6e-07 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 3/91 (3%) Frame = +1 Query: 352 DGLDTTCAICRETFIDPKVLNCFHTFCRACLD---REQTHPDRVTCVTCRVDTQLPPGGV 522 D D TC +C + F DP++L C HT+C+ CL+ + + C CR + ++ V Sbjct: 10 DEKDVTCLLCLDIFTDPRLLPCLHTYCKKCLEDLVSQCQKKGEIYCPQCRHEVKITCAQV 69 Query: 523 DSLLTNLVIAAAVDQDAELLSSGRQTSSPLG 615 +L N V + A L+S SP G Sbjct: 70 SNLKINTVANDII--AALALTSEENADSPPG 98 >SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 956 Score = 51.6 bits (118), Expect = 6e-07 Identities = 28/86 (32%), Positives = 42/86 (48%), Gaps = 4/86 (4%) Frame = +1 Query: 265 LERGSISPLTLSGSSPPASDSAVCDLRDFDGLDTTCAICRETFIDPKVLNCFHTFCRACL 444 L RG+ SP + SP S + LR + C++C +T +PK+L CFHTFC CL Sbjct: 67 LIRGNPSPSSRRERSPLQMASILDSLRQ----EAECSLCHKTPSEPKILKCFHTFCNECL 122 Query: 445 DREQTH----PDRVTCVTCRVDTQLP 510 + + +C +C+ LP Sbjct: 123 TEKSAEFKGDGETFSCPSCKTRIDLP 148 >SB_36857| Best HMM Match : zf-C3HC4 (HMM E-Value=2.8e-05) Length = 576 Score = 51.6 bits (118), Expect = 6e-07 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 3/79 (3%) Frame = +1 Query: 337 DLRDFDGLDTTCAICRETFIDPKVL-NCFHTFCRACLDREQTHPDR--VTCVTCRVDTQL 507 D G + C +C E F +PK L +C H CR CL++ V C CR +++ Sbjct: 11 DFHTLLGDEGACPVCIEVFEEPKSLPSCAHNVCRECLEKITARNSSRFVECPICRARSEI 70 Query: 508 PPGGVDSLLTNLVIAAAVD 564 P GV+S TN ++ ++ Sbjct: 71 PQNGVNSFPTNTLLVRIIE 89 >SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 50.8 bits (116), Expect = 1e-06 Identities = 26/67 (38%), Positives = 35/67 (52%), Gaps = 4/67 (5%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACL----DREQTHPDRVTCVTCRVDTQLPPGGVDS 528 + C IC E F DP+VL C HTFC CL R +T + C C++ Q+ P V S Sbjct: 13 EVECPICLERFKDPRVLPCLHTFCYECLVGLASRYKTE-GKWPCPQCKMVVQVSPAEVSS 71 Query: 529 LLTNLVI 549 L N ++ Sbjct: 72 LKVNFLM 78 >SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) Length = 203 Score = 50.8 bits (116), Expect = 1e-06 Identities = 26/67 (38%), Positives = 35/67 (52%), Gaps = 4/67 (5%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACL----DREQTHPDRVTCVTCRVDTQLPPGGVDS 528 + C IC E F DP+VL C HTFC CL R +T + C C++ Q+ P V S Sbjct: 13 EVECPICLERFKDPRVLPCLHTFCYECLVGLASRYKTE-GKWPCPQCKMVVQVSPAEVSS 71 Query: 529 LLTNLVI 549 L N ++ Sbjct: 72 LKVNFLM 78 >SB_23995| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-05) Length = 96 Score = 50.4 bits (115), Expect = 1e-06 Identities = 29/80 (36%), Positives = 42/80 (52%), Gaps = 3/80 (3%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTCVTCRVDTQ---LPPGGVDSLLTN 540 C IC E + DPK L C HT C CL E P + C +D Q +P GG+++L ++ Sbjct: 22 CPICEEEYDDPKRLPCMHTICLGCL--ESMVPKNALIMKCPIDEQELPMPMGGINALPSD 79 Query: 541 LVIAAAVDQDAELLSSGRQT 600 L I ++ ++SG QT Sbjct: 80 LRIVRLLE-----VASGGQT 94 >SB_10859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 387 Score = 50.0 bits (114), Expect = 2e-06 Identities = 25/71 (35%), Positives = 35/71 (49%), Gaps = 3/71 (4%) Frame = +1 Query: 361 DTTCAICRETFIDPKVL-NCFHTFCRACLDR--EQTHPDRVTCVTCRVDTQLPPGGVDSL 531 + +C IC E F +PK L C H CR CL E+ +R C CR +P G+D Sbjct: 22 EISCPICYEDFEEPKCLPKCAHNICRECLLGIIEKAQLERFECPICRAIVAVPKDGIDGF 81 Query: 532 LTNLVIAAAVD 564 TN ++ V+ Sbjct: 82 PTNSLLVRLVE 92 >SB_3354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 632 Score = 47.6 bits (108), Expect = 9e-06 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Frame = +1 Query: 367 TCAICRETFIDPKVLNCFHTFCRACLD---REQTHPDRVTCVTCRVDTQLPPGGVDSLL 534 TC C F +P++ C H+FC CL+ R + + + C TC+ + + P GG+ + L Sbjct: 15 TCRQCSNVFKNPRITPCLHSFCAECLNEIARSRPYQAYIACPTCKYEIRKPEGGLFNTL 73 >SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) Length = 784 Score = 45.2 bits (102), Expect = 5e-05 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 4/76 (5%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLD--REQTHPDRVTCVTCRVDTQLP--PGGVDSLLT 537 C +C + F PK+L+C H+FC++C++ +T D + + C V L P V+SL T Sbjct: 62 CRVCNQRFNKPKLLHCLHSFCQSCIEGLARKTEDDCLELI-CPVCDSLGAIPRSVESLPT 120 Query: 538 NLVIAAAVDQDAELLS 585 N + V + A S Sbjct: 121 NFALWDTVRKHANTTS 136 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 44.8 bits (101), Expect = 6e-05 Identities = 25/66 (37%), Positives = 33/66 (50%) Frame = +1 Query: 367 TCAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTCVTCRVDTQLPPGGVDSLLTNLV 546 +C +C+E FI L C H+FC CL + R TC CR Q P V S++ + Sbjct: 370 SCIVCQELFIRATTLTCSHSFCEYCL--QSWLRKRNTCPICRCAVQSQP--VRSIVLDNA 425 Query: 547 IAAAVD 564 IA VD Sbjct: 426 IAKMVD 431 >SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) Length = 843 Score = 44.8 bits (101), Expect = 6e-05 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 7/74 (9%) Frame = +1 Query: 361 DTTCAICRETFID------PKVLNCFHTFCRACLDR-EQTHPDRVTCVTCRVDTQLPPGG 519 D TC +C + P++L+C HTFC C+ + ++ D V C TC++ T L Sbjct: 327 DLTCPLCYTAYGTGYPQRIPRILDCSHTFCTECIMKIKELQGDVVECPTCKLRTLL-TSS 385 Query: 520 VDSLLTNLVIAAAV 561 VD L N+ I AV Sbjct: 386 VDCLKKNMDILTAV 399 >SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 44.4 bits (100), Expect = 9e-05 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDREQTHPD-RVTCVTCRVDTQLPPGGVDSLLTNLV 546 C++C PK+L C H+FC ACL+ T D C C + ++ + L TN Sbjct: 20 CSLCHRLIRGPKLLPCLHSFCLACLEDLVTENDVGFNCPQCHTEAKVSKAALRGLPTNFF 79 Query: 547 IAAAVD 564 + +D Sbjct: 80 LDNMLD 85 >SB_20928| Best HMM Match : NHL (HMM E-Value=0) Length = 795 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/59 (40%), Positives = 28/59 (47%), Gaps = 5/59 (8%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDREQTHPD-----RVTCVTCRVDTQLPPGGVDSL 531 C C + +PKVL C HTFC CL E+ H D VTC C D L G + L Sbjct: 15 CPKCMNAYENPKVLPCLHTFCSQCLS-EELHRDCEGRLNVTCPKCLRDFPLRDGAENPL 72 >SB_14351| Best HMM Match : zf-B_box (HMM E-Value=2.3e-12) Length = 549 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACL-DREQTHPDRVTCVTCRVDTQ 504 C C F DP++L C H+ C+ CL D EQ + C C D + Sbjct: 21 CRYCNGIFEDPRLLPCLHSLCKKCLKDIEQAQEGAIACPVCLTDVE 66 >SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLD---REQTHPDRVTCVTCRVDTQLPPGGVDSLLTN 540 C +C + +P +L C+H+FC C+ + V C CR + ++P V L +N Sbjct: 20 CPVCLGEYKNPMLLRCYHSFCLRCVQELLHQSGEKGVVKCPQCRTEMEIPNSDVKRLKSN 79 Query: 541 LVIAAAVD 564 I +D Sbjct: 80 FYINNLLD 87 >SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) Length = 321 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/50 (40%), Positives = 24/50 (48%) Frame = +1 Query: 352 DGLDTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTCVTCRVDT 501 D L C +CR+TF +P V C H FC AC Q + C C V T Sbjct: 239 DNLPFACIMCRKTFKNPVVTKCLHYFCEAC--ALQHYKKNSKCFVCGVQT 286 >SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) Length = 337 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/58 (34%), Positives = 29/58 (50%) Frame = +1 Query: 322 DSAVCDLRDFDGLDTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTCVTCRV 495 DS D +D + D TC IC + ++P VL C H FC+ C + + C CR+ Sbjct: 23 DSTQQDEKDIE--DFTCPICLQLLVEPVVLPCEHEFCKMCF-TQNVQEANLQCPMCRI 77 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 43.2 bits (97), Expect = 2e-04 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDRE 453 C++C E +PK+L CFH +C+ CL E Sbjct: 14 CSLCSEVLTEPKILRCFHVYCQKCLQAE 41 >SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 858 Score = 41.9 bits (94), Expect = 5e-04 Identities = 30/74 (40%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +1 Query: 274 GSISPLTLSGSSPPASDSAVCDLRDFDGLDTTCAICRETFIDPKVLN-CFHTFCRACLDR 450 GS +PLT SS S V D G C IC ET P+ L C HTFCR C+ Sbjct: 649 GSAAPLT---SSLGDSTLDVDMTEDGAGDSAECPICLETITYPETLQGCGHTFCRPCI-T 704 Query: 451 EQTHPDRVTCVTCR 492 E + ++ C TCR Sbjct: 705 EASKSSKL-CPTCR 717 >SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) Length = 654 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/41 (43%), Positives = 21/41 (51%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTCVTCR 492 C +C F +P C H FCRACL+R H R C CR Sbjct: 379 CTLCCRLFYNPVTTPCGHVFCRACLNRSLDH--RPGCPICR 417 Score = 31.1 bits (67), Expect = 0.85 Identities = 15/44 (34%), Positives = 18/44 (40%) Frame = +1 Query: 367 TCAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTCVTCRVD 498 +C C + P L C HT C CL + Q CV C D Sbjct: 100 SCVRCCGILLGPCTLPCGHTVCEKCLSKSQAK----KCVDCGED 139 >SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 911 Score = 41.9 bits (94), Expect = 5e-04 Identities = 30/74 (40%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +1 Query: 274 GSISPLTLSGSSPPASDSAVCDLRDFDGLDTTCAICRETFIDPKVLN-CFHTFCRACLDR 450 GS +PLT SS S V D G C IC ET P+ L C HTFCR C+ Sbjct: 724 GSAAPLT---SSLGDSTLDVDMTEDGAGDSAECPICLETITYPETLQGCGHTFCRPCI-T 779 Query: 451 EQTHPDRVTCVTCR 492 E + ++ C TCR Sbjct: 780 EASKSSKL-CPTCR 792 >SB_33464| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0019) Length = 413 Score = 41.5 bits (93), Expect = 6e-04 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = +1 Query: 370 CAICRETFIDPKVLN-CFHTFCRACLDREQTHPDRVTCVTCRVDTQLPPGGVDSLLTNLV 546 C IC E F PK L C H C +CL + + + C CR T++ +SL TN + Sbjct: 22 CPICTEIFETPKCLPVCAHNVCLSCLKKMKIEQGFIKCPICRKKTKI-TNPAESLPTNSL 80 Query: 547 IAAAVD 564 + V+ Sbjct: 81 LVRLVE 86 >SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 41.1 bits (92), Expect = 8e-04 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 1/73 (1%) Frame = +1 Query: 277 SISPLTLSGSSPPASDSAVCDLRDFDGLDTTCAICRETFIDPKVLNCFHTFCRACLDR-E 453 S+ + S S P AS + D + + C IC +T D + C H FC CL R Sbjct: 33 SVGAASSSSSEPTASHNPSEDPNSANA-NFECNICLDTARDAVISMCGHLFCWPCLHRWL 91 Query: 454 QTHPDRVTCVTCR 492 +T P+R C C+ Sbjct: 92 ETRPNRSMCPVCK 104 >SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) Length = 877 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/76 (28%), Positives = 31/76 (40%), Gaps = 2/76 (2%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDREQTHPD--RVTCVTCRVDTQLPPGGVDSLLTNL 543 C IC D +VL C HT+CR C++ H R C +C + L L Sbjct: 145 CGICHALLRDARVLPCLHTYCRRCIEDIILHRQSVRAHCPSCNREIPLDSYCTAKELPRD 204 Query: 544 VIAAAVDQDAELLSSG 591 +A A+ + L G Sbjct: 205 AVAIALQDELALRDGG 220 >SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 40.7 bits (91), Expect = 0.001 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACL 444 C +CR F DP + +C HTFC+AC+ Sbjct: 194 CPLCRRVFKDPVITSCGHTFCQACI 218 >SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) Length = 471 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/59 (30%), Positives = 29/59 (49%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTCVTCRVDTQLPPGGVDSLLTNLV 546 C +C + ++DP + C HT+C AC+ E T + C C V+ LL N++ Sbjct: 22 CGLCGDFYVDPVTILCGHTYCLACIKDEFTGKN---CKKCGFKITEESNSVNILLCNII 77 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTCVTCR 492 D C +C ++P C H+FCR CL R H RV C CR Sbjct: 327 DFECKLCFNLLLEPVTSLCGHSFCRDCLYRSLDH--RVECPCCR 368 >SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) Length = 1387 Score = 40.3 bits (90), Expect = 0.001 Identities = 36/140 (25%), Positives = 61/140 (43%), Gaps = 4/140 (2%) Frame = +1 Query: 211 ASRTPSLESLPGANSIGSLERGSISPLTLSGSSPPASDSAVCDLRDFDGLDTTCAICRET 390 A+ P + + A+++ +L+RGS + + S A +R + C IC Sbjct: 608 AAIDPPVAAHDSASTL-ALDRGSHDGVNNMAAPEERSKEAEGIIRSAHE-SSCCPICSRP 665 Query: 391 FIDPKVLNCFHTFCRACLD---REQTHPDRVTCVTCRVDTQLP-PGGVDSLLTNLVIAAA 558 F PK+L C HT+C C+ R + + C C +P P D+L +L Sbjct: 666 FKSPKILPCLHTYCSDCVKEIVRSRLGKLTLQCPKCPRSVDIPDPFTPDTLPFSLYHRRL 725 Query: 559 VDQDAELLSSGRQTSSPLGS 618 + D LL + + +S+ GS Sbjct: 726 L--DLRLLENPQDSSASCGS 743 >SB_47830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 767 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = +1 Query: 367 TCAICRETFIDPKVLNCFHTFCRACLDREQTHP---DRVTCVTCRVDTQL 507 TC+ C+ + +PK L C H FC CL + Q +R+ C TC + L Sbjct: 17 TCSACKGFYKNPKRLPCLHAFCCHCLKKTQRGTKLCERMRCPTCDYELDL 66 >SB_15354| Best HMM Match : NHL (HMM E-Value=4.4e-14) Length = 1071 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +1 Query: 367 TCAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTCVTCRV 495 TC C+ET DP +L C + CR+C + + V CR+ Sbjct: 118 TCPSCKETMNDPVLLPCLDSICRSCCQKSAQKHGNMWNVLCRL 160 >SB_29658| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0012) Length = 450 Score = 37.9 bits (84), Expect = 0.007 Identities = 29/86 (33%), Positives = 39/86 (45%), Gaps = 6/86 (6%) Frame = +1 Query: 367 TCAICRETFID----PKVLNCFHTFCRACLDREQTHPDRVTCVTCRVDTQLPPGGVDSLL 534 TC IC F D P L C HT C+ACL Q H + V+T + V++ L Sbjct: 13 TCPICYHEFEDRQRGPISLACGHTICKACL--SQLHKTQCPFDQATVNTDIDKLPVNTAL 70 Query: 535 TNLVIAAAVDQDAEL--LSSGRQTSS 606 LV+ A D L + + R+ SS Sbjct: 71 LQLVVLGASVMDYPLPDIPNVRENSS 96 >SB_8285| Best HMM Match : Filamin (HMM E-Value=1.1e-09) Length = 474 Score = 37.9 bits (84), Expect = 0.007 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 355 GLDTTCAICRETFIDPKVLNCFHTFCRACLDRE 453 G+ C C DP++L C H+ C+ CL+++ Sbjct: 14 GVSLYCPACSNVIKDPRILPCLHSICKTCLEKQ 46 >SB_4351| Best HMM Match : zf-B_box (HMM E-Value=1.3e-25) Length = 662 Score = 37.9 bits (84), Expect = 0.007 Identities = 30/99 (30%), Positives = 43/99 (43%), Gaps = 14/99 (14%) Frame = +1 Query: 346 DFDGLDTTCAICRETFI--DPKVLNCFHTFCRACL----DREQTHPDRVTCVTCRVDT-- 501 D D + C ICR++ +PK+L C H+FC CL D++Q + T Sbjct: 14 DEDSVFMICGICRKSSATSNPKLLPCLHSFCFGCLEEKFDQQQQQEQKQNSTTSSSSASS 73 Query: 502 ------QLPPGGVDSLLTNLVIAAAVDQDAELLSSGRQT 600 + P G + L+ IA +D L S GRQT Sbjct: 74 SPLQRLKCPTCGQEFLVPPKGIAGFLDNQFMLESLGRQT 112 >SB_49217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 609 Score = 37.5 bits (83), Expect = 0.010 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 4/32 (12%) Frame = +1 Query: 361 DTTCAICRETFID----PKVLNCFHTFCRACL 444 + TC +C+E F + PK+L+C HT C+AC+ Sbjct: 217 ECTCGVCQEEFNEKTRVPKLLHCSHTLCKACV 248 >SB_31924| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00073) Length = 498 Score = 37.5 bits (83), Expect = 0.010 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 4/32 (12%) Frame = +1 Query: 361 DTTCAICRETFID----PKVLNCFHTFCRACL 444 + TC +C+E F + PK+L+C HT C+AC+ Sbjct: 320 ECTCGVCQEEFNEKTRVPKLLHCSHTLCKACV 351 >SB_45821| Best HMM Match : zf-B_box (HMM E-Value=1.1e-12) Length = 379 Score = 37.1 bits (82), Expect = 0.013 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 367 TCAICRETFIDPKVLNCFHTFCRACLDR-EQTHPDRVTCVTCRV 495 TC C+ET P +L C + CR+C + Q H D T V CR+ Sbjct: 26 TCPSCKETMNGPVLLPCLDSICRSCCQKTAQKHGDTWT-VPCRL 68 >SB_32308| Best HMM Match : MIF4G (HMM E-Value=1.5e-17) Length = 605 Score = 37.1 bits (82), Expect = 0.013 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 367 TCAICRETFIDPKVLNCFHTFCRACLDR-EQTHPDRVTCVTCRV 495 TC C+ET P +L C + CR+C + Q H D T V CR+ Sbjct: 26 TCPSCKETMNGPVLLPCLDSICRSCCQKTAQKHGDTWT-VPCRL 68 >SB_31116| Best HMM Match : zf-C3HC4 (HMM E-Value=5.6e-10) Length = 169 Score = 36.3 bits (80), Expect = 0.023 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 367 TCAICRETFIDPKVLN-CFHTFCRACLDREQTHPDRVTCVTC 489 TC +C I P + C HTFC++C+ + TC +C Sbjct: 63 TCGLCEGYLIKPTTITECLHTFCKSCIVTYLQDSEDNTCPSC 104 >SB_14207| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0048) Length = 233 Score = 36.3 bits (80), Expect = 0.023 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTCVTCRVD 498 C C++ + P C H C+ CL R + TC CR D Sbjct: 105 CVCCQDLVLYPVTTKCLHNICKGCLQR-SFKAEVFTCPYCRTD 146 >SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1555 Score = 36.3 bits (80), Expect = 0.023 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVT 477 D+ CAIC DP + +C H++C+ C+ + + + T Sbjct: 27 DSMCAICHIVVKDPILTSCGHSYCKCCIQKWRNRMEEFT 65 >SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) Length = 380 Score = 36.3 bits (80), Expect = 0.023 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 355 GLDTTCAICRETFIDPKVLNCFHTFCRACL-DREQTHPDRVTCVTCR 492 G+ C IC + DP + C H FC CL D + C CR Sbjct: 60 GVSEECPICLDPLDDPSITRCAHVFCTGCLTDVIENEGLAPRCPMCR 106 >SB_58465| Best HMM Match : zf-B_box (HMM E-Value=0.00022) Length = 476 Score = 33.9 bits (74), Expect = 0.12 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 6/82 (7%) Frame = +1 Query: 400 PKVLNCFHTFCRACLDR--EQTHPDRVTCVTCRVDTQLPP--GGVDSLLTNLVIAAAVD- 564 P+ LNC HT+C CL + Q+ V C C+ +T L G+ SL N + ++ Sbjct: 157 PRNLNCGHTYCTGCLGKLSAQSQYAFVRCPACKHETLLLSRFNGIPSLPKNFGLLEIIES 216 Query: 565 -QDAELLSSGRQTSSPLGSLHR 627 ++A+ + T + HR Sbjct: 217 KENADKAPASASTIDQERAKHR 238 >SB_30622| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-14) Length = 856 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 400 PKVLNCFHTFCRACLDR-EQTHPDRVTCVTCRVDTQLPPGGVDSLL 534 P +L C HT+C +C+ + + +V C C+ TQL G+ +L Sbjct: 405 PLLLECGHTYCDSCIIKLSRLQKTQVACPECQHVTQLKAEGIAGVL 450 >SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 346 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTCVTCR 492 C IC + C H+FC +CL+ + P+ +C +CR Sbjct: 18 CNICVGVLENAITTICGHSFCESCLETWLSRPEVQSCPSCR 58 >SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) Length = 310 Score = 33.5 bits (73), Expect = 0.16 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDREQTH 462 C ICR+ +P + C H++C AC+ TH Sbjct: 18 CCICRDVLEEPLMAPCEHSYCSACVLGWLTH 48 >SB_12693| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0014) Length = 413 Score = 33.5 bits (73), Expect = 0.16 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTF 429 + TC++C E F DP+VL+C +F Sbjct: 73 EVTCSLCIEHFTDPRVLHCLRSF 95 >SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 33.1 bits (72), Expect = 0.21 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDR--EQTHPDRVTCVTCRVDTQLPPG 516 CAIC+E P C H FC C+ +QT+ ++ C C+ + PG Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCICEWLDQTY-NKSGCPVCK--ASISPG 207 >SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 262 Score = 33.1 bits (72), Expect = 0.21 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDR--EQTHPDRVTCVTCRVDTQLPPG 516 CAIC+E P C H FC C+ +QT+ ++ C C+ + PG Sbjct: 34 CAICKEVLTQPIATPCDHYFCVLCICEWLDQTY-NKSGCPVCK--ASISPG 81 >SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 33.1 bits (72), Expect = 0.21 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDR--EQTHPDRVTCVTCRVDTQLPPG 516 CAIC+E P C H FC C+ +QT+ ++ C C+ + PG Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCICEWLDQTY-NKSGCPVCK--ASISPG 207 >SB_1298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1668 Score = 32.7 bits (71), Expect = 0.28 Identities = 22/62 (35%), Positives = 31/62 (50%) Frame = +2 Query: 215 HAPRPLSRCPVPTQ*VRWSVAPYRPSLSAVHHPLRATPPYVIYATSTDSIPLAPSAVRHS 394 HA +P+ C VPT V S++ R S P + + S+ S P++PSAV H Sbjct: 475 HAYQPVRTCAVPTSYVSTSLSASRIHTST-SSPQMSFSSRDSLSVSSLSPPISPSAVDHQ 533 Query: 395 ST 400 ST Sbjct: 534 ST 535 >SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 32.7 bits (71), Expect = 0.28 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 361 DTTCAICRETFIDPKVLNCFHTFCRACL 444 D C IC DP V C H FC CL Sbjct: 54 DFKCGICFGVLEDPLVTTCGHVFCSQCL 81 >SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 32.7 bits (71), Expect = 0.28 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDR--EQTHPDRVTCVTCR 492 CAIC+E P C H FC C+ +QT+ ++ C C+ Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCICEWLDQTY-NKSGCPVCK 201 >SB_41147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 332 Score = 32.3 bits (70), Expect = 0.37 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 9/46 (19%) Frame = +1 Query: 361 DTTCAICRETFIDP-KVLNCFHTFCRACLD--------REQTHPDR 471 D C IC+ F DP + +C H FC +CL+ R++ +PD+ Sbjct: 39 DYQCPICQLPFRDPVQTRDCGHRFCESCLEPILRRCISRDKVYPDK 84 >SB_18583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 31.9 bits (69), Expect = 0.49 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 472 VTCVTCRVDTQLPPGGVDSLLTNLVIAAAVD 564 +TC TCR +T +P GV+SL N + +D Sbjct: 165 LTCPTCRKETPIPETGVESLHLNFFVNQMLD 195 >SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 31.5 bits (68), Expect = 0.64 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +1 Query: 370 CAICRETFIDP-KVLNCFHTFCRACL 444 C IC+ F DP ++ C H FC++CL Sbjct: 26 CPICQLAFRDPIQIEECGHRFCQSCL 51 >SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1094 Score = 31.5 bits (68), Expect = 0.64 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDR 450 C+ CR+ ++ P V C H C C ++ Sbjct: 18 CSYCRKVYLHPLVTGCGHVLCTKCYNK 44 >SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) Length = 398 Score = 31.1 bits (67), Expect = 0.85 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +1 Query: 367 TCAICRETFIDP---KVLNCFHTFCRACLDREQTHPDRVTCVTCRVDT 501 +C IC E F ++L C H +C CL R + TC CR T Sbjct: 261 SCPICLEEFTPETPTRLLVCGHKYCEPCLSR--WLENNTTCPICRKPT 306 >SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) Length = 306 Score = 31.1 bits (67), Expect = 0.85 Identities = 15/49 (30%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDR------EQTHPDRVTCVTCRVD 498 C IC E + C H+FC CL+ E+ +C +CR D Sbjct: 18 CGICAEVLERAVLTPCGHSFCGVCLETWMNAKLEENEKCPASCPSCRAD 66 >SB_19621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 730 Score = 30.7 bits (66), Expect = 1.1 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 376 ICRETFIDPKVLNCFHTFCRACLDR-EQTHPDR---VTCVTCRVDTQLPPGGV 522 ICRE PK L C H +C C+D +T D+ TC CR + PG V Sbjct: 281 ICRER---PKTLPCLHHYCAKCIDPWIKTCSDQGINSTCPECR--SPFKPGDV 328 >SB_52170| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) Length = 291 Score = 30.7 bits (66), Expect = 1.1 Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +1 Query: 370 CAICRETFIDPK-VLNCFHTFCRACLDR 450 C +C +D ++ C H+FCR C+ R Sbjct: 48 CVLCGGYLVDATTIIECLHSFCRCCIVR 75 >SB_24433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 486 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = +1 Query: 358 LDTTCAICRETFIDPKVLNCFHTFCRACLDREQTHPDRVTCVTCR--VDT 501 +D C IC I + L C H CR+C+ R + C C+ VDT Sbjct: 426 VDELCPICCAMRISVRFLPCRHVSCRSCITRHLM--NNKECFFCKEVVDT 473 >SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) Length = 510 Score = 30.7 bits (66), Expect = 1.1 Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +1 Query: 370 CAICRETFIDPK-VLNCFHTFCRACLDR 450 C +C +D ++ C H+FCR C+ R Sbjct: 16 CVLCGGYLVDATTIIECLHSFCRCCIVR 43 >SB_59800| Best HMM Match : SPRY (HMM E-Value=7.8e-05) Length = 1444 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +1 Query: 448 REQTHPDRVTCVTCRVDTQLPPGGVDSLLTNLVIAAAVDQ-DAELLSSGRQTSSP 609 + PD V C +CR + P GVD+L NL++ +++ E GR + P Sbjct: 186 KSHLEPD-VKCPSCRRKIPVDPRGVDALPRNLILENVIERFKEERAVPGRGNTKP 239 >SB_45256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +1 Query: 367 TCAICRETFIDP-KVLNCFHTFCRACLDREQ 456 +C +CR +DP +C H CR CL +++ Sbjct: 40 SCRVCRGLVVDPFGSQSCLHYVCRGCLRKKR 70 >SB_33756| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0035) Length = 351 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +1 Query: 367 TCAICRETFIDP-KVLNCFHTFCRACLDREQ 456 +C +CR +DP +C H CR CL +++ Sbjct: 40 SCRVCRGLVVDPFGSQSCLHYVCRGCLRKKR 70 >SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +1 Query: 220 TPSLESLPGANSIGSLERGSISP--LTLSGSSPPASDSAVCDLRDFDGLDTT 369 +P E PGAN S +R SP LT + + + AV + +G D+T Sbjct: 230 SPCSEPTPGANEFLSTQRNQTSPVQLTRNSDDEKSDEEAVDSNNELEGKDST 281 >SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1716 Score = 29.9 bits (64), Expect = 2.0 Identities = 9/26 (34%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +1 Query: 370 CAICRETFIDPK-VLNCFHTFCRACL 444 C +C +D ++ C H+FCR+C+ Sbjct: 1366 CVLCGGYLVDATTIVECLHSFCRSCI 1391 >SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) Length = 2009 Score = 29.9 bits (64), Expect = 2.0 Identities = 26/87 (29%), Positives = 37/87 (42%), Gaps = 6/87 (6%) Frame = +2 Query: 176 SVCFGMPVS*RWPHAPRPLSRCPVPTQ*VRWSVAPYRPSLSAVHH--PLRATPPY----V 337 + C P+ R H P LSR + V P R +HH P A+ PY + Sbjct: 755 TACHIFPIRLRALHLPHTLSRAASTPYAIACRVYPIRHCAPHLHHTPPRAASTPYATVRL 814 Query: 338 IYATSTDSIPLAPSAVRHSSTPKYLTA 418 IY ++ L + R +S+P Y TA Sbjct: 815 IYFIRHHALHLPHTPSRATSSP-YATA 840 >SB_56584| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) Length = 158 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 367 TCAICRETFIDPKVLNCFHTFCRACL 444 TC C D + CFH FC CL Sbjct: 105 TCPCCNTRKKDAILTKCFHVFCYECL 130 >SB_49784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/32 (53%), Positives = 19/32 (59%) Frame = -1 Query: 452 SLSRQARQKV*KQLSTLGSMNVSRQMAQVVSS 357 S SRQ RQ KQ STLGS+ S + V SS Sbjct: 5 SSSRQCRQNEWKQGSTLGSLKCSIHIEHVTSS 36 >SB_44886| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) Length = 406 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 367 TCAICRETFIDPKVLNCFHTFCRACL 444 TC C D + CFH FC CL Sbjct: 353 TCPCCNTRKKDAILTKCFHVFCYECL 378 >SB_38758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/54 (31%), Positives = 29/54 (53%) Frame = +1 Query: 220 TPSLESLPGANSIGSLERGSISPLTLSGSSPPASDSAVCDLRDFDGLDTTCAIC 381 TP+ +S+ G E+ + L +SG++P A+ A C R++ G+ C IC Sbjct: 229 TPNPQSVRNLKERGFEEKEIMVALKVSGNNPEAASFAFC-FRNYQGI---CCIC 278 >SB_20851| Best HMM Match : Cbl_N3 (HMM E-Value=0) Length = 695 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDREQ 456 C IC E D ++ C H C CL++ Q Sbjct: 185 CKICAENNKDVRIEPCGHLMCHLCLEQWQ 213 >SB_51713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 867 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDREQ 456 C IC E D ++ C H C CL++ Q Sbjct: 381 CKICAENNKDVRIEPCGHLMCHLCLEQWQ 409 >SB_37498| Best HMM Match : MATH (HMM E-Value=1.8e-28) Length = 562 Score = 29.1 bits (62), Expect = 3.4 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = +1 Query: 370 CAICRETFIDPKVLNCFHTFCRACLDREQTH 462 C IC+ +P C H C +C + H Sbjct: 34 CTICKHVLQEPLQTTCGHRICESCFELSLRH 64 >SB_25082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 585 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/46 (39%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +1 Query: 364 TTCAICRETFIDPKVLNCFHT-FCRACLDREQTHPDRVTCVTCRVD 498 T C IC E + +LNC H CR C +Q H C CR D Sbjct: 536 TQCVICLENQRNVVLLNCGHVCSCRTC--AQQIH----QCPVCRGD 575 >SB_698| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00037) Length = 303 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +1 Query: 352 DGLDTTCAICRETFI---DPKVLNCFHTFCRACL 444 +G+D C IC E + K L C H F AC+ Sbjct: 251 EGIDDVCLICMEEYAVGDSMKYLPCRHNFHSACI 284 >SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) Length = 665 Score = 28.3 bits (60), Expect = 6.0 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +2 Query: 227 PLSRCPVPTQ*VRWS-VAPYRPSLSAVHHPLRATPPYVIYATSTDSIP 367 PLS P+P + ++ V Y P S++HH P +IY + SIP Sbjct: 282 PLSS-PIPHRHHLYTTVIIYTPPSSSIHHCHHLYPTVIIYTPPSSSIP 328 >SB_43998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 28.3 bits (60), Expect = 6.0 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 10/80 (12%) Frame = +2 Query: 296 SAVHHPLRATPPYVIYATST---DSIPLAPSAVRHS-------STPKYLTAFILFAGLAW 445 S HHP ++TP +IY +T PS H+ STP Y+T + + + + Sbjct: 13 SYAHHPQQSTPSTIIYTVNTYPHHQQLSTPSIAIHTYLHHPQLSTP-YITIYTIHSYPHY 71 Query: 446 TENRPTRTE*RALLVVLTLN 505 T+ TE +LVV ++ Sbjct: 72 TQQSKALTELIGMLVVFFIS 91 >SB_41628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 690 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = +1 Query: 337 DLRDFDGLDTTCAICRETFIDPKV---LNCFHTFCRAC 441 D RD+ + C IC F + K+ ++C H+FC C Sbjct: 301 DTRDWFMVSKECGICFGDFRENKMTALMSCGHSFCTEC 338 >SB_106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 28.3 bits (60), Expect = 6.0 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 15/69 (21%) Frame = +1 Query: 361 DTTCAICRETFID-PK--------VLNCFHTFCRACLD--REQTHPDRV---TCVTCRVD 498 + TCA+C + + PK + NC H FC C+ R+ +H ++ C CR Sbjct: 171 NVTCAVCLDVVMSKPKQSERRFGILPNCIHAFCLECIRKWRKASHAEKKVVRACPICRTP 230 Query: 499 T-QLPPGGV 522 + + P GV Sbjct: 231 SGYVVPSGV 239 >SB_47760| Best HMM Match : DUF1168 (HMM E-Value=2.1) Length = 438 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 226 SLESLPGANSIGSLERGSISPLTLSGSSPPASD 324 S + LP +I S + G ++PL S SPP+S+ Sbjct: 313 SEDDLPTIPNIPSTDEGQVNPLYESEPSPPSSE 345 >SB_4531| Best HMM Match : zf-C3HC4 (HMM E-Value=0.098) Length = 533 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +1 Query: 331 VCDLRDFDGLDTTCAICRETFIDPKVLNCFHTFCRACLD 447 +CD ++ L TT C LNCFHTF CL+ Sbjct: 437 ICDYKNCTQLSTTNVNC---------LNCFHTFHNFCLE 466 >SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) Length = 2478 Score = 27.9 bits (59), Expect = 7.9 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 1/79 (1%) Frame = -1 Query: 410 STLGSMNVSRQMAQVVSSPSKSRKSHTAESLAGGDEPLRVRGDMEPRS-SEPIELAPGSD 234 S + N R ++ SK + +++AG D + G+ +PRS SE + S Sbjct: 2387 SKMDLFNSGRHFSRSGEIASKEEAYYHNKNMAGMDNDVFYSGETKPRSKSEAVYTNGTSS 2446 Query: 233 SRDGVREAIFRKPASQSKP 177 SR ++ + +SQ P Sbjct: 2447 SRSSDKDRKGSRSSSQRNP 2465 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,325,155 Number of Sequences: 59808 Number of extensions: 457729 Number of successful extensions: 1714 Number of sequences better than 10.0: 119 Number of HSP's better than 10.0 without gapping: 1449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1690 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -