BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0616 (674 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 22 4.7 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 4.7 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 8.1 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 8.1 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 22.2 bits (45), Expect = 4.7 Identities = 12/45 (26%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +1 Query: 193 AGFLKMASRTPSLESLPGANSIGSLERGSISP-LTLSGSSPPASD 324 AG A+ TP+ S+P +++ G++ P + +G SD Sbjct: 42 AGTSTTAAATPTPPSVPVGSAVAGTAGGALFPGMAAAGKGAARSD 86 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.2 bits (45), Expect = 4.7 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = +2 Query: 263 RWSVAPYRPSLSAVHHPLRAT 325 +W + Y PS H +R+T Sbjct: 511 QWGILVYEPSACRPRHEIRST 531 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.4 bits (43), Expect = 8.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 444 GQRTDPPGQSNVRYLSC*HSIATRWC*QP 530 G++ DP G RYL + TR+ +P Sbjct: 436 GRKADPNGDYIRRYLPVLKNFPTRYIHEP 464 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 8.1 Identities = 12/50 (24%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = +1 Query: 217 RTPSLESLPGANS-----IGSLERGSISPLTLSGSSPPASDSAVCDLRDF 351 +T + +SL N+ G + GS+ L + G+ P + + + +DF Sbjct: 23 KTEAFDSLHAGNAEKTLCSGQVCLGSVMQLPIHGTEPRSKEEILLHAKDF 72 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,967 Number of Sequences: 438 Number of extensions: 3767 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -