BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0615 (696 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0160 - 20427774-20428217,20428301-20428402,20428503-204285... 33 0.22 >02_04_0160 - 20427774-20428217,20428301-20428402,20428503-20428595, 20428675-20428860,20428966-20429213,20429292-20429412, 20430674-20430718,20431086-20431138,20431152-20431173 Length = 437 Score = 33.1 bits (72), Expect = 0.22 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = -3 Query: 580 LLKSRHVKLRIAPYQCLCEFMTRINTVYRISLYLLYNTLC 461 LLK++ K+ +A YQC+ MT++ Y + + LY T C Sbjct: 161 LLKAKFPKISMADYQCV---MTQVERQYNVRRHKLYKTYC 197 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,874,665 Number of Sequences: 37544 Number of extensions: 244753 Number of successful extensions: 353 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 352 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -