BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0615 (696 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC017710-1|AAH17710.1| 423|Homo sapiens zinc finger protein 271... 30 6.9 BC004510-1|AAH04510.2| 272|Homo sapiens ZNF271 protein protein. 30 6.9 AF159567-1|AAD43569.1| 423|Homo sapiens epstein-barr virus-indu... 30 6.9 AF153201-1|AAD38056.1| 423|Homo sapiens zinc finger protein dp ... 30 6.9 Z74696-1|CAI42428.1| 376|Homo sapiens actin-related protein T1 ... 30 9.1 BC014597-1|AAH14597.1| 376|Homo sapiens actin-related protein T... 30 9.1 AF440739-1|AAM00432.1| 376|Homo sapiens actin-related protein T... 30 9.1 >BC017710-1|AAH17710.1| 423|Homo sapiens zinc finger protein 271 protein. Length = 423 Score = 30.3 bits (65), Expect = 6.9 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +2 Query: 98 CVIRMRLQKSYRRDQPY-CL*CSENCSKLSAVEI 196 C + QK++ ++PY C+ CS +CS+LS + I Sbjct: 346 CTDLIEHQKTHAEEKPYQCVQCSRSCSQLSELTI 379 >BC004510-1|AAH04510.2| 272|Homo sapiens ZNF271 protein protein. Length = 272 Score = 30.3 bits (65), Expect = 6.9 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +2 Query: 98 CVIRMRLQKSYRRDQPY-CL*CSENCSKLSAVEI 196 C + QK++ ++PY C+ CS +CS+LS + I Sbjct: 195 CTDLIEHQKTHAEEKPYQCVQCSRSCSQLSELTI 228 >AF159567-1|AAD43569.1| 423|Homo sapiens epstein-barr virus-induced zinc finger protein protein. Length = 423 Score = 30.3 bits (65), Expect = 6.9 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +2 Query: 98 CVIRMRLQKSYRRDQPY-CL*CSENCSKLSAVEI 196 C + QK++ ++PY C+ CS +CS+LS + I Sbjct: 346 CTDLIEHQKTHAEEKPYQCVQCSRSCSQLSELTI 379 >AF153201-1|AAD38056.1| 423|Homo sapiens zinc finger protein dp protein. Length = 423 Score = 30.3 bits (65), Expect = 6.9 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +2 Query: 98 CVIRMRLQKSYRRDQPY-CL*CSENCSKLSAVEI 196 C + QK++ ++PY C+ CS +CS+LS + I Sbjct: 346 CTDLIEHQKTHAEEKPYQCVQCSRSCSQLSELTI 379 >Z74696-1|CAI42428.1| 376|Homo sapiens actin-related protein T1 (ACTRT1) protein. Length = 376 Score = 29.9 bits (64), Expect = 9.1 Identities = 9/30 (30%), Positives = 20/30 (66%) Frame = +3 Query: 21 IYLSNYAFSCSFHR*TVANLKQNICFVSLE 110 ++ S + F C ++ V N+K+ +C+++LE Sbjct: 196 LFASGFNFPCILNKAVVNNIKEKLCYIALE 225 >BC014597-1|AAH14597.1| 376|Homo sapiens actin-related protein T1 protein. Length = 376 Score = 29.9 bits (64), Expect = 9.1 Identities = 9/30 (30%), Positives = 20/30 (66%) Frame = +3 Query: 21 IYLSNYAFSCSFHR*TVANLKQNICFVSLE 110 ++ S + F C ++ V N+K+ +C+++LE Sbjct: 196 LFASGFNFPCILNKAVVNNIKEKLCYIALE 225 >AF440739-1|AAM00432.1| 376|Homo sapiens actin-related protein T1 protein. Length = 376 Score = 29.9 bits (64), Expect = 9.1 Identities = 9/30 (30%), Positives = 20/30 (66%) Frame = +3 Query: 21 IYLSNYAFSCSFHR*TVANLKQNICFVSLE 110 ++ S + F C ++ V N+K+ +C+++LE Sbjct: 196 LFASGFNFPCILNKAVVNNIKEKLCYIALE 225 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,449,921 Number of Sequences: 237096 Number of extensions: 1448919 Number of successful extensions: 5732 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 5695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5731 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8007229802 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -