BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0613 (637 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 25 0.81 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 25 0.81 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 23 1.9 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 22 4.3 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 22 5.7 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 22 5.7 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 7.6 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 7.6 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 24.6 bits (51), Expect = 0.81 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +1 Query: 106 TTNGIWNWIKVGRPRGWRQYSKR 174 T N + N++K RP+ W + S + Sbjct: 82 TANKVVNYLKTKRPKDWERLSAK 104 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 24.6 bits (51), Expect = 0.81 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +1 Query: 106 TTNGIWNWIKVGRPRGWRQYSKR 174 T N + N++K RP+ W + S + Sbjct: 82 TANKVVNYLKTKRPKDWERLSAK 104 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 85 SGRNLTSTTNGIWNW 129 SG+NLT+T N I W Sbjct: 28 SGKNLTNTLNVIHKW 42 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 22.2 bits (45), Expect = 4.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 61 TGSDPFWRSGRNLTSTT 111 TG +W G+NL TT Sbjct: 138 TGGSCYWPRGKNLGGTT 154 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.8 bits (44), Expect = 5.7 Identities = 6/11 (54%), Positives = 10/11 (90%) Frame = -3 Query: 149 LGRPTLIQFHI 117 LG+PT++ FH+ Sbjct: 26 LGQPTIVYFHV 36 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.8 bits (44), Expect = 5.7 Identities = 9/34 (26%), Positives = 14/34 (41%) Frame = +1 Query: 79 WRSGRNLTSTTNGIWNWIKVGRPRGWRQYSKRSE 180 WR R + T NW+ V W+ +R + Sbjct: 148 WRDARIVNGTRQPPNNWLSVFWGSAWQWNEERKQ 181 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.4 bits (43), Expect = 7.6 Identities = 5/9 (55%), Positives = 8/9 (88%) Frame = +1 Query: 112 NGIWNWIKV 138 NG+W WI++ Sbjct: 56 NGLWRWIRL 64 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.4 bits (43), Expect = 7.6 Identities = 5/9 (55%), Positives = 8/9 (88%) Frame = +1 Query: 112 NGIWNWIKV 138 NG+W WI++ Sbjct: 94 NGLWRWIRL 102 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,868 Number of Sequences: 438 Number of extensions: 3314 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -