BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0612 (733 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF513635-1|AAM53607.1| 212|Anopheles gambiae glutathione S-tran... 26 1.4 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 5.6 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 24 5.6 >AF513635-1|AAM53607.1| 212|Anopheles gambiae glutathione S-transferase D4 protein. Length = 212 Score = 25.8 bits (54), Expect = 1.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 432 PETKDIANLQKAADFVKAFIY 494 P K + LQKA D +++F+Y Sbjct: 120 PSEKQVQRLQKAVDVLESFLY 140 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.8 bits (49), Expect = 5.6 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Frame = -2 Query: 276 H*GLNFFYVFFGSF*ASLDCFPQLWALQPPYHLRCHL*LCALYF*ASSSF--*LAKNH-Q 106 H GL Y++ G + CF ++ QP + + L +LY +SS +AKNH + Sbjct: 343 HFGLGQMYIYRGDSENAAQCFEKVLKAQPGNYETMKI-LGSLYATSSSQSKRDIAKNHLK 401 Query: 105 HLCSPFP 85 + FP Sbjct: 402 KVTEQFP 408 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.8 bits (49), Expect = 5.6 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +3 Query: 267 DPNESKVAMRKVAVPAHRYTPLKESWLKIFTPIVEHLLLQV 389 D N S + A AHR P SW+ V+ LL Q+ Sbjct: 885 DANASNPGASRYARWAHRLIPEVHSWMAQKRGEVDFLLAQI 925 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 621,392 Number of Sequences: 2352 Number of extensions: 10953 Number of successful extensions: 31 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -