BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0612 (733 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 25 0.56 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 23 2.2 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 5.2 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 5.2 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 6.8 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 6.8 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 25.4 bits (53), Expect = 0.56 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 1/79 (1%) Frame = +3 Query: 267 DPNESKVAMRKVAVPAHRYTPLKESWLKIF-TPIVEHLLLQVRFNTKTRNVEIKVGPETK 443 DP E V A YTPLKE + P +E L F+T+ + VG E++ Sbjct: 179 DPPEPPVPTVTSACVGSAYTPLKEDHDDHYGVPTLEEL----GFDTEGLLPPVWVGGESE 234 Query: 444 DIANLQKAADFVKAFIYGF 500 +A L++ + KA++ F Sbjct: 235 ALARLERHLE-RKAWVASF 252 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 23.4 bits (48), Expect = 2.2 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 468 QLSVNLQYLLFLVRLLSQHSSFSC*TLLVAISV 370 ++ + QYLL L+R L Q S+ TLL SV Sbjct: 135 KVDMTRQYLLQLIRNLRQSSALDGVTLLADNSV 167 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +3 Query: 648 IENVTKTRIVLADSKIIFWAVIRYCFGK 731 IEN+ R LA + + W + +C K Sbjct: 199 IENIGSIRWELAGTLAVVWIMCYFCIWK 226 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +3 Query: 648 IENVTKTRIVLADSKIIFWAVIRYCFGK 731 IEN+ R LA + + W + +C K Sbjct: 252 IENIGSIRWELAGTLAVVWIMCYFCIWK 279 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.8 bits (44), Expect = 6.8 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +3 Query: 582 NGDHLSR-AIGRLAGKAGRTKFTIENVTKTRIVLADSKIIFWAVIRYCF 725 +G +LS A G++ G+ + N +T + A + WA+ R CF Sbjct: 152 DGKYLSTLAPGKVLGELA----ILYNCKRTATITAATDCQLWAIDRQCF 196 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 6.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 516 RHHQLQNH 493 RHH LQNH Sbjct: 140 RHHHLQNH 147 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,762 Number of Sequences: 438 Number of extensions: 3151 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -