BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0610 (750 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) 51 1e-06 SB_53171| Best HMM Match : SpdB (HMM E-Value=7.6) 28 9.3 >SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) Length = 229 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = +2 Query: 656 IDIDTRAYFTSATIIIAVPTGIKIFR*LATI 748 +++DTRAYFT+AT+IIAVPTGIK+F LAT+ Sbjct: 1 MNVDTRAYFTAATMIIAVPTGIKVFSWLATL 31 >SB_53171| Best HMM Match : SpdB (HMM E-Value=7.6) Length = 414 Score = 27.9 bits (59), Expect = 9.3 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -1 Query: 87 GGRSQNLILFIRGNAISGAPSI 22 GG S+NLI F G I G PS+ Sbjct: 99 GGESKNLINFALGQDIGGVPSV 120 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,808,743 Number of Sequences: 59808 Number of extensions: 287326 Number of successful extensions: 670 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 666 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -