BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0607 (650 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC146.01 |med15|SPBP35G2.15|mediator complex subunit Med15 |Sc... 26 5.4 SPAC22H10.11c ||||Schizosaccharomyces pombe|chr 1|||Manual 25 9.5 SPAC4D7.06c |||siroheme synthase |Schizosaccharomyces pombe|chr ... 25 9.5 >SPBC146.01 |med15|SPBP35G2.15|mediator complex subunit Med15 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1063 Score = 25.8 bits (54), Expect = 5.4 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +3 Query: 33 AQSPE*ASPRKARGTRPTAASITGQSRRQHGSSRLQRQAEEVIPQCY 173 AQ + + R + PT+AS+T Q+ +Q +++L A + Q Y Sbjct: 451 AQQQQQQQQQLHRTSNPTSASVTSQNGQQPINTKLSANAAKTNYQSY 497 >SPAC22H10.11c ||||Schizosaccharomyces pombe|chr 1|||Manual Length = 629 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +1 Query: 385 MSLIRKKVQEFEHINGYYSMPELVRKPVE 471 M+L +++E++ NGY + E+ + P E Sbjct: 1 MALTNGRIEEYDIQNGYQNTEEIKKLPAE 29 >SPAC4D7.06c |||siroheme synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 264 Score = 25.0 bits (52), Expect = 9.5 Identities = 11/44 (25%), Positives = 24/44 (54%) Frame = +2 Query: 14 RMIMEICSVAGVSVASKSERNATDRCLHYWPESAATWKFSASTP 145 R ++EIC + + + + N +R L Y+P+ +++ +TP Sbjct: 193 RWMIEICELWSLEELAMLDENLINRLLGYFPKKTPSYR-EITTP 235 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,241,391 Number of Sequences: 5004 Number of extensions: 41346 Number of successful extensions: 100 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -