BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0605 (721 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 28 0.33 AY341235-1|AAR13799.1| 196|Anopheles gambiae transferrin-like p... 24 5.4 AY341234-1|AAR13798.1| 196|Anopheles gambiae transferrin-like p... 24 5.4 AY341233-1|AAR13797.1| 196|Anopheles gambiae transferrin-like p... 24 5.4 AY341232-1|AAR13796.1| 196|Anopheles gambiae transferrin-like p... 24 5.4 AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 23 9.5 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 27.9 bits (59), Expect = 0.33 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 264 EFTAPKLYFRPDDKLILGGT-FLHTDSHHIWLFSLVL 371 E+ KL + PDD GG LH S HIWL +VL Sbjct: 79 EWNDYKLKWNPDD---YGGVDTLHVPSEHIWLPDIVL 112 >AY341235-1|AAR13799.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 129 FGLLFILAFIVIYRRRNILDRNK 61 FG + +AF+ + R R I DRN+ Sbjct: 71 FGGIASIAFVNVGRSRGIFDRNE 93 >AY341234-1|AAR13798.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 129 FGLLFILAFIVIYRRRNILDRNK 61 FG + +AF+ + R R I DRN+ Sbjct: 71 FGGIASIAFVNVGRSRGIFDRNE 93 >AY341233-1|AAR13797.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 129 FGLLFILAFIVIYRRRNILDRNK 61 FG + +AF+ + R R I DRN+ Sbjct: 71 FGGIASIAFVNVGRSRGIFDRNE 93 >AY341232-1|AAR13796.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 129 FGLLFILAFIVIYRRRNILDRNK 61 FG + +AF+ + R R I DRN+ Sbjct: 71 FGGIASIAFVNVGRSRGIFDRNE 93 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 315 GGTFLHTDSHHIWLFSLVL 371 G T L+ S HIWL +VL Sbjct: 106 GVTELYVPSEHIWLPDIVL 124 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 717,313 Number of Sequences: 2352 Number of extensions: 14277 Number of successful extensions: 15 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -