BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0605 (721 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 28 0.10 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 23 2.9 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 5.1 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 21 8.9 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 21 8.9 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 27.9 bits (59), Expect = 0.10 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 264 EFTAPKLYFRPDDKLILGGT-FLHTDSHHIWLFSLVL 371 E+ KL + PDD GG LH S HIWL +VL Sbjct: 76 EWNDYKLKWNPDD---YGGVDTLHVPSEHIWLPDIVL 109 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 315 GGTFLHTDSHHIWLFSLVL 371 G T L+ S HIWL +VL Sbjct: 91 GVTELYVPSEHIWLPDIVL 109 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.2 bits (45), Expect = 5.1 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 297 DDKLILGGTFLHTDSHHIWLFSLVL 371 D K G LH S HIW +VL Sbjct: 89 DPKEYGGVEMLHVPSDHIWRPDIVL 113 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +3 Query: 315 GGTFLHTDSHHIWLFSLVL 371 G LH S HIW +VL Sbjct: 99 GVKMLHVPSDHIWRPDIVL 117 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +3 Query: 315 GGTFLHTDSHHIWLFSLVL 371 G LH S HIW +VL Sbjct: 99 GVKMLHVPSDHIWRPDIVL 117 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,620 Number of Sequences: 438 Number of extensions: 4250 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -