BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0604 (578 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38) 47 1e-05 SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25) 47 1e-05 SB_41989| Best HMM Match : RVT_1 (HMM E-Value=1.2e-33) 47 1e-05 SB_26363| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_18722| Best HMM Match : RVT_1 (HMM E-Value=2.8e-08) 47 1e-05 SB_13911| Best HMM Match : PAN (HMM E-Value=0.033) 46 2e-05 SB_9821| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_36643| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_51049| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_23180| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_28986| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_42464| Best HMM Match : Pro_isomerase (HMM E-Value=3.9e-06) 41 8e-04 SB_37284| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_31729| Best HMM Match : RVT_1 (HMM E-Value=0.023) 41 8e-04 SB_18811| Best HMM Match : RVT_1 (HMM E-Value=0.075) 41 8e-04 SB_6304| Best HMM Match : RVT_1 (HMM E-Value=3.2e-18) 40 0.001 SB_48079| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_34166| Best HMM Match : RVT_1 (HMM E-Value=1e-23) 39 0.003 SB_8056| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_17856| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_41411| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 37 0.014 SB_45459| Best HMM Match : RVT_1 (HMM E-Value=6e-36) 36 0.024 SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) 36 0.032 SB_13395| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_27725| Best HMM Match : RVT_1 (HMM E-Value=1.9e-19) 35 0.042 SB_1380| Best HMM Match : RVT_1 (HMM E-Value=1.4e-38) 35 0.042 SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) 35 0.042 SB_19895| Best HMM Match : PHD (HMM E-Value=3.8e-08) 35 0.042 SB_29299| Best HMM Match : RVT_1 (HMM E-Value=0.00029) 35 0.055 SB_22988| Best HMM Match : RVT_1 (HMM E-Value=5.70328e-43) 34 0.073 SB_38529| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.073 SB_28491| Best HMM Match : RVT_1 (HMM E-Value=0.00037) 34 0.073 SB_41513| Best HMM Match : RVT_1 (HMM E-Value=8.9e-21) 33 0.13 SB_40625| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40) 33 0.13 SB_27128| Best HMM Match : PADR1 (HMM E-Value=8.3) 33 0.13 SB_11753| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.13 SB_7615| Best HMM Match : RVT_1 (HMM E-Value=1e-33) 33 0.13 SB_3345| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_32202| Best HMM Match : RVT_1 (HMM E-Value=0.1) 33 0.13 SB_24534| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.13 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_1851| Best HMM Match : RVT_1 (HMM E-Value=3.2e-16) 33 0.13 SB_31162| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_46891| Best HMM Match : RVT_1 (HMM E-Value=1.6e-05) 33 0.22 SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_41944| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_35755| Best HMM Match : RVT_1 (HMM E-Value=1.90001e-40) 33 0.22 SB_35248| Best HMM Match : DUF999 (HMM E-Value=2.7) 33 0.22 SB_24803| Best HMM Match : LRR_1 (HMM E-Value=0.0066) 33 0.22 SB_21595| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.22 SB_56322| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_52166| Best HMM Match : Exo_endo_phos (HMM E-Value=5.6e-10) 33 0.22 SB_50593| Best HMM Match : KIX (HMM E-Value=8) 33 0.22 SB_47325| Best HMM Match : RVT_1 (HMM E-Value=2.2e-31) 33 0.22 SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28) 33 0.22 SB_36989| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.29 SB_13612| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.29 SB_5302| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.29 SB_42513| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) 32 0.29 SB_32833| Best HMM Match : RVT_1 (HMM E-Value=2) 32 0.29 SB_28083| Best HMM Match : Uso1_p115_C (HMM E-Value=5.7) 32 0.29 SB_21258| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.29 SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1) 32 0.39 SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_11072| Best HMM Match : SH2 (HMM E-Value=6.4) 32 0.39 SB_9950| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4) 32 0.39 SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1) 32 0.39 SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_53026| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) 32 0.39 SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) 32 0.39 SB_20131| Best HMM Match : RVT_1 (HMM E-Value=0.0049) 32 0.39 SB_59615| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.51 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.51 SB_57033| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.51 SB_46731| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) 31 0.51 SB_21468| Best HMM Match : RVT_1 (HMM E-Value=1.2) 31 0.51 SB_30009| Best HMM Match : RVT_1 (HMM E-Value=1.2e-18) 31 0.68 SB_28319| Best HMM Match : zf-C2H2 (HMM E-Value=0.012) 31 0.68 SB_23239| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.68 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.68 SB_27212| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 31 0.68 SB_53252| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.90 SB_39712| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_35875| Best HMM Match : RVT_1 (HMM E-Value=5.2e-24) 31 0.90 SB_35814| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_43443| Best HMM Match : Phage_fiber (HMM E-Value=3.8) 31 0.90 SB_41460| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.90 SB_33259| Best HMM Match : RVT_1 (HMM E-Value=4.3e-12) 31 0.90 SB_28157| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.90 SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_19684| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.90 SB_55435| Best HMM Match : RVT_1 (HMM E-Value=7.9e-22) 30 1.2 SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_51188| Best HMM Match : RVT_1 (HMM E-Value=4.5e-24) 30 1.2 SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) 30 1.2 SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.2 SB_40223| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.2 SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) 30 1.2 SB_31085| Best HMM Match : RVT_1 (HMM E-Value=0.0094) 30 1.2 SB_29894| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.2 SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) 30 1.2 SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_45895| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 30 1.2 SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) 30 1.2 SB_40728| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) 30 1.2 SB_27722| Best HMM Match : RVT_1 (HMM E-Value=0.00011) 30 1.2 SB_26566| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_22389| Best HMM Match : RVT_1 (HMM E-Value=1.6e-37) 30 1.2 SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_6541| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_3959| Best HMM Match : RVT_1 (HMM E-Value=6.4e-40) 30 1.2 SB_962| Best HMM Match : RVT_1 (HMM E-Value=2.5e-36) 30 1.2 SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) 30 1.6 SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.6 SB_51225| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_45791| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.2) 30 1.6 SB_42960| Best HMM Match : RVT_1 (HMM E-Value=2.38221e-44) 30 1.6 SB_40804| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_27537| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.6 SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.6 SB_58057| Best HMM Match : RVT_1 (HMM E-Value=0.0085) 30 1.6 SB_45340| Best HMM Match : RVT_1 (HMM E-Value=1.2e-15) 30 1.6 SB_38334| Best HMM Match : RVT_1 (HMM E-Value=5.60519e-45) 30 1.6 SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) 30 1.6 SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_27764| Best HMM Match : RVT_1 (HMM E-Value=3.99931e-42) 30 1.6 SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14) 30 1.6 SB_25119| Best HMM Match : Ribosomal_S27 (HMM E-Value=9.4) 30 1.6 SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_24072| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_15469| Best HMM Match : RVT_1 (HMM E-Value=0.00014) 30 1.6 SB_7145| Best HMM Match : RVT_1 (HMM E-Value=3.8e-25) 30 1.6 SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022) 29 2.1 SB_58643| Best HMM Match : RhoGAP (HMM E-Value=3.7) 29 2.1 SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_50566| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) 29 2.1 SB_37794| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_34933| Best HMM Match : RVT_1 (HMM E-Value=3.5e-08) 29 2.1 SB_33707| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11) 29 2.1 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 29 2.1 SB_31784| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 29 2.1 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 29 2.1 SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_20480| Best HMM Match : RVT_1 (HMM E-Value=0.00014) 29 2.1 SB_19328| Best HMM Match : RVT_1 (HMM E-Value=2e-36) 29 2.1 SB_7036| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6) 29 2.1 SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) 29 2.1 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 29 2.1 SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) 29 2.1 SB_55944| Best HMM Match : RVT_1 (HMM E-Value=1.6e-11) 29 2.1 SB_54400| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_50273| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_50090| Best HMM Match : SPC22 (HMM E-Value=2.8) 29 2.1 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 29 2.1 SB_42434| Best HMM Match : RVT_1 (HMM E-Value=2.7e-18) 29 2.1 SB_41552| Best HMM Match : RVT_1 (HMM E-Value=5.4e-32) 29 2.1 SB_31122| Best HMM Match : RVT_1 (HMM E-Value=0.0033) 29 2.1 SB_29550| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_23136| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_21992| Best HMM Match : LRR_1 (HMM E-Value=3.2e-07) 29 2.1 SB_21912| Best HMM Match : RhoGAP (HMM E-Value=3.7) 29 2.1 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 29 2.1 SB_19159| Best HMM Match : RVT_1 (HMM E-Value=0.00032) 29 2.1 SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) 29 2.1 SB_18732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) 29 2.1 SB_12628| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_11213| Best HMM Match : RVT_1 (HMM E-Value=6.4e-38) 29 2.1 SB_10602| Best HMM Match : RVT_1 (HMM E-Value=1.3e-10) 29 2.1 SB_6740| Best HMM Match : RVT_1 (HMM E-Value=4.5e-22) 29 2.1 SB_5957| Best HMM Match : Chitin_synth_1 (HMM E-Value=9) 29 2.1 SB_3856| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_2811| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_267| Best HMM Match : RhoGAP (HMM E-Value=3.7) 29 2.1 SB_51570| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) 29 2.7 SB_36682| Best HMM Match : RVT_1 (HMM E-Value=0.0067) 29 2.7 SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) 29 2.7 SB_32869| Best HMM Match : Toxin_7 (HMM E-Value=3.9) 29 2.7 SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) 29 2.7 SB_29603| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_25070| Best HMM Match : RVT_1 (HMM E-Value=1.4e-15) 29 2.7 SB_21953| Best HMM Match : UME (HMM E-Value=6.1) 29 2.7 SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) 29 2.7 SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) 29 2.7 SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_56675| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-08) 29 2.7 SB_55170| Best HMM Match : RVT_1 (HMM E-Value=0.16) 29 2.7 SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) 29 2.7 SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_41699| Best HMM Match : RVT_1 (HMM E-Value=1.90002e-41) 29 2.7 SB_39321| Best HMM Match : RVT_1 (HMM E-Value=4.5e-39) 29 2.7 SB_36757| Best HMM Match : RVT_1 (HMM E-Value=4.1e-28) 29 2.7 SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 29 2.7 SB_12357| Best HMM Match : RVT_1 (HMM E-Value=7.69999e-41) 29 2.7 SB_3152| Best HMM Match : RVT_1 (HMM E-Value=5.4006e-42) 29 2.7 SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15) 29 3.6 SB_56299| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) 29 3.6 SB_52531| Best HMM Match : RVT_1 (HMM E-Value=1e-08) 29 3.6 SB_40620| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_37487| Best HMM Match : RVT_1 (HMM E-Value=0.03) 29 3.6 SB_36818| Best HMM Match : RVT_1 (HMM E-Value=8e-35) 29 3.6 SB_35764| Best HMM Match : RVT_1 (HMM E-Value=8.1e-13) 29 3.6 SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) 29 3.6 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 29 3.6 SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) 29 3.6 SB_25600| Best HMM Match : RVT_1 (HMM E-Value=0.0074) 29 3.6 SB_19870| Best HMM Match : RVT_1 (HMM E-Value=0.18) 29 3.6 SB_5465| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_59500| Best HMM Match : RVT_1 (HMM E-Value=0.015) 29 3.6 SB_57293| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_50676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_45260| Best HMM Match : RVT_1 (HMM E-Value=1.2) 29 3.6 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_27893| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) 29 3.6 SB_23276| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) 29 3.6 SB_8130| Best HMM Match : RVT_1 (HMM E-Value=8e-35) 29 3.6 SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36) 29 3.6 SB_59080| Best HMM Match : RVT_1 (HMM E-Value=1.2e-35) 28 4.8 SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) 28 4.8 SB_54448| Best HMM Match : RVT_1 (HMM E-Value=0.096) 28 4.8 SB_47691| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_41718| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) 28 4.8 SB_37650| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_32446| Best HMM Match : RVT_1 (HMM E-Value=0.04) 28 4.8 SB_32337| Best HMM Match : CaMBD (HMM E-Value=5.9) 28 4.8 SB_32070| Best HMM Match : RVT_1 (HMM E-Value=2.4e-15) 28 4.8 SB_31876| Best HMM Match : RVT_1 (HMM E-Value=0) 28 4.8 SB_19821| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_16148| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_13918| Best HMM Match : RVT_1 (HMM E-Value=5.2e-07) 28 4.8 SB_3037| Best HMM Match : Homeobox (HMM E-Value=4.3e-27) 28 4.8 SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) 28 4.8 SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_56454| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_54068| Best HMM Match : RVT_1 (HMM E-Value=0.92) 28 4.8 SB_51607| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_38851| Best HMM Match : RVT_1 (HMM E-Value=9.8e-20) 28 4.8 SB_37101| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_28404| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_24913| Best HMM Match : RVT_1 (HMM E-Value=1e-20) 28 4.8 SB_24501| Best HMM Match : RVT_1 (HMM E-Value=4.2e-37) 28 4.8 SB_19795| Best HMM Match : RVT_1 (HMM E-Value=1.3) 28 4.8 SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 28 4.8 SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) 28 4.8 SB_10718| Best HMM Match : RVT_1 (HMM E-Value=2.3e-33) 28 4.8 SB_9873| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_8967| Best HMM Match : RVT_1 (HMM E-Value=7.6e-18) 28 4.8 SB_6922| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) 28 4.8 SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) 28 4.8 SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_40707| Best HMM Match : RVT_1 (HMM E-Value=0.17) 28 6.3 SB_9841| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_50555| Best HMM Match : Glutaredoxin (HMM E-Value=4.9) 27 8.4 SB_14910| Best HMM Match : RVT_1 (HMM E-Value=0.47) 27 8.4 SB_44324| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_40145| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_38806| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_37732| Best HMM Match : RVT_1 (HMM E-Value=2e-23) 27 8.4 SB_10715| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 >SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38) Length = 492 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/65 (33%), Positives = 34/65 (52%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPWTXXXXXXXXXXXXXICLLA 295 D + G +QGCLLSP LF++ +D +M+ T + R G+ WT + LL+ Sbjct: 181 DAFEIRTGVRQGCLLSPFLFLLAIDWIMKTSTDQKRNGIQWTLWKQLDDLDFANDLALLS 240 Query: 294 TNRQQ 280 +QQ Sbjct: 241 HTQQQ 245 Score = 40.7 bits (91), Expect = 8e-04 Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 11/59 (18%) Frame = -1 Query: 284 SSTDSAPMSIKGRHIEQVGSFCYLGSIVDDRGGT--------GR---PFSQLRPVWSSS 141 ++++ P++++G +E+V +F YLGSI+D +GGT G+ F QL+ +W SS Sbjct: 275 NASNETPITVQGEALEEVDTFTYLGSILDKQGGTDADIRTRIGKARAAFHQLKNIWGSS 333 >SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25) Length = 1641 Score = 47.2 bits (107), Expect = 1e-05 Identities = 24/77 (31%), Positives = 39/77 (50%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPWTXXXXXXXXXXXXXICLLATNRQ 283 + G +QGCLLSP LF++ +D +M+ T + R G+ WT + LL+ +Q Sbjct: 311 IRTGVRQGCLLSPFLFLLAIDWIMKTSTDQKRNGIQWTLWKQLDYLDFADDLALLSHTQQ 370 Query: 282 QHRFGSYVDQREAHRAG 232 Q + + + A R G Sbjct: 371 QMQEKTNIVADNAARLG 387 Score = 44.0 bits (99), Expect = 9e-05 Identities = 17/48 (35%), Positives = 32/48 (66%) Frame = -1 Query: 284 SSTDSAPMSIKGRHIEQVGSFCYLGSIVDDRGGTGRPFSQLRPVWSSS 141 ++++ P++++G +E+V +F YLGSI+D++GGT +W SS Sbjct: 401 NASNETPITVQGEALEEVDTFTYLGSILDNQGGTDADIRTRIELWGSS 448 Score = 38.3 bits (85), Expect = 0.004 Identities = 20/59 (33%), Positives = 37/59 (62%), Gaps = 11/59 (18%) Frame = -1 Query: 284 SSTDSAPMSIKGRHIEQVGSFCYLGSIVDDRGGT--------GR---PFSQLRPVWSSS 141 ++++ ++++G +E+V +F YLGSI+D++GGT G+ F QL+ +W SS Sbjct: 30 NASNETXITVQGEALEEVDTFTYLGSILDNQGGTDADIRTRIGKALAAFHQLKNIWGSS 88 >SB_41989| Best HMM Match : RVT_1 (HMM E-Value=1.2e-33) Length = 585 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/65 (33%), Positives = 34/65 (52%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPWTXXXXXXXXXXXXXICLLA 295 D + G +QGCLLSP LF++ +D +M+ T + R G+ WT + LL+ Sbjct: 249 DAFEIRTGVRQGCLLSPFLFLLAIDWIMKTSTDQKRNGIQWTLWKQLDDLDFANDLALLS 308 Query: 294 TNRQQ 280 +QQ Sbjct: 309 HTQQQ 313 >SB_26363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1054 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/65 (33%), Positives = 34/65 (52%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPWTXXXXXXXXXXXXXICLLA 295 D + G +QGCLLSP LF++ +D +M+ T + R G+ WT + LL+ Sbjct: 753 DAFEIRTGVRQGCLLSPFLFLLAIDWIMKTSTDQKRNGIQWTLWKQLDDLDFADDLALLS 812 Query: 294 TNRQQ 280 +QQ Sbjct: 813 HTQQQ 817 Score = 38.3 bits (85), Expect = 0.004 Identities = 13/33 (39%), Positives = 27/33 (81%) Frame = -1 Query: 284 SSTDSAPMSIKGRHIEQVGSFCYLGSIVDDRGG 186 ++++ P++++G +E+V +F YLGSI+D++GG Sbjct: 847 NASNETPITVQGEALEEVDTFTYLGSILDNQGG 879 >SB_18722| Best HMM Match : RVT_1 (HMM E-Value=2.8e-08) Length = 421 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/65 (33%), Positives = 34/65 (52%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPWTXXXXXXXXXXXXXICLLA 295 D + G +QGCLLSP LF++ +D +M+ T + R G+ WT + LL+ Sbjct: 109 DAFEIRTGVRQGCLLSPFLFLLAIDWIMKTSTDQKRNGIQWTLWKQLDDLDFADDLALLS 168 Query: 294 TNRQQ 280 +QQ Sbjct: 169 HTQQQ 173 Score = 38.3 bits (85), Expect = 0.004 Identities = 13/33 (39%), Positives = 27/33 (81%) Frame = -1 Query: 284 SSTDSAPMSIKGRHIEQVGSFCYLGSIVDDRGG 186 ++++ P++++G +E+V +F YLGSI+D++GG Sbjct: 203 NASNETPITVQGEALEEVDTFTYLGSILDNQGG 235 >SB_13911| Best HMM Match : PAN (HMM E-Value=0.033) Length = 534 Score = 46.4 bits (105), Expect = 2e-05 Identities = 18/43 (41%), Positives = 28/43 (65%) Frame = -3 Query: 477 LDNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPWT 349 +D + G +QGCLLSP LF++ +D +M+ T + R G+ WT Sbjct: 72 IDAFEIRTGVRQGCLLSPFLFLLAIDWIMKTSTDQKRNGIQWT 114 Score = 39.1 bits (87), Expect = 0.003 Identities = 14/34 (41%), Positives = 26/34 (76%) Frame = -1 Query: 284 SSTDSAPMSIKGRHIEQVGSFCYLGSIVDDRGGT 183 +++ P++++G +E+V +F YLGSI+D +GGT Sbjct: 167 NASSETPITVQGEALEEVDTFTYLGSILDKQGGT 200 >SB_9821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 46.4 bits (105), Expect = 2e-05 Identities = 17/38 (44%), Positives = 27/38 (71%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPWT 349 V +G +QGC++SPLLF++ +D +MR T +G+ WT Sbjct: 127 VNSGVRQGCIISPLLFLLAIDWIMRNTTADKPRGIQWT 164 >SB_36643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 537 Score = 45.6 bits (103), Expect = 3e-05 Identities = 18/42 (42%), Positives = 27/42 (64%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPWT 349 D + G +QGCLLSP LF++ +D +M+ T + R G+ WT Sbjct: 287 DAFEIRTGVRQGCLLSPFLFLLAIDWIMKTSTDQKRNGIQWT 328 Score = 40.7 bits (91), Expect = 8e-04 Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 11/59 (18%) Frame = -1 Query: 284 SSTDSAPMSIKGRHIEQVGSFCYLGSIVDDRGGT--------GR---PFSQLRPVWSSS 141 ++++ P++++G +E+V +F YLGSI+D +GGT G+ F QL+ +W SS Sbjct: 380 NASNETPITVQGETLEEVDTFTYLGSILDKQGGTDADIRTRIGKARAAFHQLKNIWGSS 438 >SB_51049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/59 (35%), Positives = 38/59 (64%), Gaps = 11/59 (18%) Frame = -1 Query: 284 SSTDSAPMSIKGRHIEQVGSFCYLGSIVDDRGGT--------GR---PFSQLRPVWSSS 141 ++++ P++++G +E+V +F YLGSI+D++GGT G+ F QL+ +W SS Sbjct: 29 NASNETPITVQGEALEEVDTFTYLGSILDNQGGTDADIRTRIGKARAAFHQLKNIWGSS 87 >SB_23180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/59 (35%), Positives = 38/59 (64%), Gaps = 11/59 (18%) Frame = -1 Query: 284 SSTDSAPMSIKGRHIEQVGSFCYLGSIVDDRGGT--------GR---PFSQLRPVWSSS 141 ++++ P++++G +E+V +F YLGSI+D++GGT G+ F QL+ +W SS Sbjct: 56 NASNETPITVQGEALEEVDTFTYLGSILDNQGGTDADIRTRIGKALAAFHQLKNIWGSS 114 >SB_28986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 41.1 bits (92), Expect = 6e-04 Identities = 24/82 (29%), Positives = 39/82 (47%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPWTXXXXXXXXXXXXXICLLATNRQ 283 + G KQGC +S +F++V+D ++RR K G+ W I LL++ + Sbjct: 339 IKTGVKQGCNMSGFIFLLVMDWILRRSVGKGENGIQWKFTSKLDDLDFADDIALLSSTKH 398 Query: 282 QHRFGSYVDQREAHRAGGKLLL 217 + + EA RAG K+ L Sbjct: 399 HIQEKTAKLDGEARRAGLKINL 420 >SB_42464| Best HMM Match : Pro_isomerase (HMM E-Value=3.9e-06) Length = 454 Score = 40.7 bits (91), Expect = 8e-04 Identities = 16/34 (47%), Positives = 23/34 (67%) Frame = +3 Query: 477 MGKIMLEMYWKHAPLTCRNFMELVRRGYYNNTKF 578 +G I +E++ K P CRNF++L GYY+NT F Sbjct: 12 VGDIDIELWGKETPKACRNFIQLCLEGYYDNTIF 45 >SB_37284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1031 Score = 40.7 bits (91), Expect = 8e-04 Identities = 15/28 (53%), Positives = 23/28 (82%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVT 379 V +G +QGC+LSP+LF+V +D +MR+ T Sbjct: 973 VNSGVRQGCILSPILFLVAIDWIMRQTT 1000 >SB_31729| Best HMM Match : RVT_1 (HMM E-Value=0.023) Length = 423 Score = 40.7 bits (91), Expect = 8e-04 Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 11/59 (18%) Frame = -1 Query: 284 SSTDSAPMSIKGRHIEQVGSFCYLGSIVDDRGGT--------GR---PFSQLRPVWSSS 141 ++++ P++++G +E+V +F YLGSI+D +GGT G+ F QL+ +W SS Sbjct: 266 NASNETPITVQGEALEEVDTFTYLGSILDKQGGTDADIRTRIGKARAAFHQLKNIWGSS 324 >SB_18811| Best HMM Match : RVT_1 (HMM E-Value=0.075) Length = 203 Score = 40.7 bits (91), Expect = 8e-04 Identities = 24/82 (29%), Positives = 39/82 (47%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPWTXXXXXXXXXXXXXICLLATNRQ 283 + G KQGC +S +F++V+D ++RR K G+ W I LL++ + Sbjct: 82 IKTGVKQGCNMSGFMFLLVMDWILRRSVGKGENGIRWKFTSKLDDLDFANDIALLSSTKH 141 Query: 282 QHRFGSYVDQREAHRAGGKLLL 217 + + EA RAG K+ L Sbjct: 142 HIQEKTAKLDGEARRAGLKINL 163 >SB_6304| Best HMM Match : RVT_1 (HMM E-Value=3.2e-18) Length = 404 Score = 40.3 bits (90), Expect = 0.001 Identities = 25/82 (30%), Positives = 39/82 (47%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPWTXXXXXXXXXXXXXICLLATNRQ 283 + G KQGC +S +F++V+D V+RR K G+ W I LL++ + Sbjct: 293 IKMGVKQGCNMSGFMFLLVMDWVLRRSVGKGENGIRWKFTSKLDDLDFADDIALLSSTKH 352 Query: 282 QHRFGSYVDQREAHRAGGKLLL 217 + + EA RAG K+ L Sbjct: 353 HIQEKTARLDGEARRAGLKINL 374 >SB_48079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 40.3 bits (90), Expect = 0.001 Identities = 24/82 (29%), Positives = 38/82 (46%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPWTXXXXXXXXXXXXXICLLATNRQ 283 + G KQGC +S +F++V+D ++RR K G+ W I LL + + Sbjct: 36 IKTGVKQGCNMSGFMFLLVMDWILRRSVGKGENGIRWKFTSKLDDLDFADNIALLCSTKH 95 Query: 282 QHRFGSYVDQREAHRAGGKLLL 217 + + EA RAG K+ L Sbjct: 96 HIQEKTAKLDGEARRAGLKINL 117 >SB_34166| Best HMM Match : RVT_1 (HMM E-Value=1e-23) Length = 385 Score = 38.7 bits (86), Expect = 0.003 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPWT 349 V G +QGC+ SP+LF+V +D +MR+ T +G+ T Sbjct: 142 VNFGVRQGCIHSPILFLVAIDWIMRQTTSDKTRGIQLT 179 >SB_8056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 37.1 bits (82), Expect = 0.010 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPW 352 + G KQGC +S +F++V+D ++RR K G+ W Sbjct: 54 IKTGVKQGCNMSGFMFLLVMDWILRRSVGKGENGIRW 90 >SB_17856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 37.1 bits (82), Expect = 0.010 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = -3 Query: 477 LDNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVT 379 +D + G +QGCLLSP LF++ +D +M+ T Sbjct: 147 IDAFEIRTGVRQGCLLSPFLFLLAIDWIMKTST 179 >SB_41411| Best HMM Match : RVT_1 (HMM E-Value=0.00044) Length = 647 Score = 36.7 bits (81), Expect = 0.014 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPW 352 + G KQGC +S +F++V+D ++RR K G+ W Sbjct: 455 IKTGIKQGCNMSGFMFLLVMDWILRRSVGKGENGIRW 491 >SB_45459| Best HMM Match : RVT_1 (HMM E-Value=6e-36) Length = 1346 Score = 35.9 bits (79), Expect = 0.024 Identities = 23/57 (40%), Positives = 31/57 (54%) Frame = -3 Query: 522 SKVHVSNTFPT*FFPLDNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPW 352 S+V VSN+ +D+ V G QG +LSP LFIVVL+ ++ R G PW Sbjct: 1143 SRVCVSNSL------MDSFKVQVGVHQGSVLSPFLFIVVLE----ALSADFRSGCPW 1189 >SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) Length = 634 Score = 35.5 bits (78), Expect = 0.032 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = -3 Query: 447 KQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPW 352 +QG +LSPLLFI+VL+ ++C R+G PW Sbjct: 284 EQGSVLSPLLFIIVLE----ALSCDLRRGCPW 311 >SB_13395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 35.5 bits (78), Expect = 0.032 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = -3 Query: 465 VVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 +VT+G QG ++ PLLF++ ++D+ + CK R Sbjct: 290 IVTSGVPQGSVVGPLLFLLYINDLPDGINCKIR 322 >SB_27725| Best HMM Match : RVT_1 (HMM E-Value=1.9e-19) Length = 262 Score = 35.1 bits (77), Expect = 0.042 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPW 352 D+ V G QG +LSP LFIVVL+ ++ R G PW Sbjct: 152 DSFKVQVGVHQGSVLSPFLFIVVLE----ALSADLRSGCPW 188 >SB_1380| Best HMM Match : RVT_1 (HMM E-Value=1.4e-38) Length = 622 Score = 35.1 bits (77), Expect = 0.042 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPW 352 D+ V G QG +LSP LFIVVL+ ++ R G PW Sbjct: 294 DSFKVQVGVHQGSVLSPFLFIVVLE----ALSADLRSGCPW 330 >SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) Length = 280 Score = 35.1 bits (77), Expect = 0.042 Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -3 Query: 486 FFPLDNIVVTAGAKQGCLLSPLLFIVVLDDVMRRV-TC 376 F+ +N++V G KQGC+LSP L + + D+ ++ TC Sbjct: 117 FYNSNNLIVLNGVKQGCMLSPTLLNLYVHDLSEQLDTC 154 >SB_19895| Best HMM Match : PHD (HMM E-Value=3.8e-08) Length = 335 Score = 35.1 bits (77), Expect = 0.042 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPW 352 D+ V G QG +LSP LFIVVL+ ++ R G PW Sbjct: 33 DSFKVKVGVHQGSVLSPFLFIVVLE----ALSADLRSGCPW 69 >SB_29299| Best HMM Match : RVT_1 (HMM E-Value=0.00029) Length = 298 Score = 34.7 bits (76), Expect = 0.055 Identities = 13/18 (72%), Positives = 17/18 (94%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLD 400 G ++GCLLSPLLF++VLD Sbjct: 161 GVRKGCLLSPLLFLIVLD 178 Score = 33.9 bits (74), Expect = 0.096 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = -1 Query: 290 IGSSTDSAPMSIKGRHIEQVGSFCYLGSIVDDRGGTG 180 I ++ ++ + K + +E+V SF YLGSIV+ GG+G Sbjct: 246 ISTTKNAGAIMCKDQPLERVESFTYLGSIVNTTGGSG 282 >SB_22988| Best HMM Match : RVT_1 (HMM E-Value=5.70328e-43) Length = 1029 Score = 34.3 bits (75), Expect = 0.073 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMR 388 D +V+T G QG +L PLLFI+ ++D R Sbjct: 838 DEVVLTHGVPQGSVLGPLLFIIYINDFHR 866 >SB_38529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 34.3 bits (75), Expect = 0.073 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 G +QGCLLSPLLF++ LD V + + + G+ Sbjct: 54 GVRQGCLLSPLLFLIELDWVTTQAYGENKTGI 85 >SB_28491| Best HMM Match : RVT_1 (HMM E-Value=0.00037) Length = 214 Score = 34.3 bits (75), Expect = 0.073 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPW 352 D+ V G QG +LSP LFIVVL+ + R G PW Sbjct: 87 DSFKVKVGVHQGSVLSPFLFIVVLEALF----ADLRSGCPW 123 >SB_41513| Best HMM Match : RVT_1 (HMM E-Value=8.9e-21) Length = 1080 Score = 33.5 bits (73), Expect = 0.13 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PL+F++ ++D+ + C R Sbjct: 638 VTSGVPQGTVLGPLMFLLFINDMQENLECTLR 669 >SB_40625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 33.5 bits (73), Expect = 0.13 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC +S +F++V+D ++RR K G+ Sbjct: 37 IKTGVKQGCNMSGFMFLLVMDWILRRSVGKGENGI 71 >SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40) Length = 325 Score = 33.5 bits (73), Expect = 0.13 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PL+F++ ++D+ + C R Sbjct: 239 VTSGVPQGTVLGPLMFLLFINDMQENLECTLR 270 >SB_27128| Best HMM Match : PADR1 (HMM E-Value=8.3) Length = 242 Score = 33.5 bits (73), Expect = 0.13 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PL+F++ ++D+ + C R Sbjct: 58 VTSGVPQGTVLGPLMFLLFINDMQENLECTLR 89 >SB_11753| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 393 Score = 33.5 bits (73), Expect = 0.13 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PL+F++ ++D+ + C R Sbjct: 239 VTSGVPQGTVLGPLMFLLFINDMQENLECTLR 270 >SB_7615| Best HMM Match : RVT_1 (HMM E-Value=1e-33) Length = 363 Score = 33.5 bits (73), Expect = 0.13 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PL+F++ ++D+ + C R Sbjct: 179 VTSGVPQGTVLGPLMFLLFINDMQENLECTLR 210 >SB_3345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.5 bits (73), Expect = 0.13 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = -3 Query: 486 FFPLDNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 F+ N + G KQGC++SP LF L D+ ++ K R + Sbjct: 30 FYLSTNTLQVQGVKQGCMISPTLFNFYLSDLPEKLNEKYRNDI 72 >SB_32202| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 259 Score = 33.5 bits (73), Expect = 0.13 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PL+F++ ++D+ + C R Sbjct: 75 VTSGVPQGTVLGPLMFLLFINDMQENLECTLR 106 >SB_24534| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 423 Score = 33.5 bits (73), Expect = 0.13 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PL+F++ ++D+ + C R Sbjct: 239 VTSGVPQGTVLGPLMFLLFINDMQENLECTLR 270 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.5 bits (73), Expect = 0.13 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PL+F++ ++D+ + C R Sbjct: 14 VTSGVPQGTVLGPLMFLLFINDMQENLECTLR 45 >SB_1851| Best HMM Match : RVT_1 (HMM E-Value=3.2e-16) Length = 287 Score = 33.5 bits (73), Expect = 0.13 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PL+F++ ++D+ + C R Sbjct: 103 VTSGVPQGTVLGPLMFLLFINDMQENLECTLR 134 >SB_31162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 33.1 bits (72), Expect = 0.17 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -3 Query: 477 LDNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 L + VT+G QG L PL+F++ ++D+ + C R Sbjct: 112 LKPVDVTSGVPQGTALGPLMFLLFINDMQENLECTLR 148 >SB_46891| Best HMM Match : RVT_1 (HMM E-Value=1.6e-05) Length = 235 Score = 32.7 bits (71), Expect = 0.22 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -3 Query: 456 AGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 AG KQGC++SP LF L D+ ++ K R + Sbjct: 153 AGVKQGCMISPTLFNFYLSDLPEKLNEKYRNDI 185 >SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 32.7 bits (71), Expect = 0.22 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PL+F++ ++D+ +T + R Sbjct: 228 VTSGVPQGTVLGPLMFLLFINDINSGITSRIR 259 >SB_41944| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 32.7 bits (71), Expect = 0.22 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -3 Query: 456 AGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 AG KQGC++SP LF L D+ ++ K R + Sbjct: 53 AGVKQGCMISPTLFNFYLSDLPEKLNEKYRNDI 85 >SB_35755| Best HMM Match : RVT_1 (HMM E-Value=1.90001e-40) Length = 414 Score = 32.7 bits (71), Expect = 0.22 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -3 Query: 456 AGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 AG KQGC++SP LF L D+ ++ K R + Sbjct: 153 AGVKQGCMISPTLFNFYLSDLPEKLNEKYRNDI 185 >SB_35248| Best HMM Match : DUF999 (HMM E-Value=2.7) Length = 189 Score = 32.7 bits (71), Expect = 0.22 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -3 Query: 456 AGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 AG KQGC++SP LF L D+ ++ K R + Sbjct: 153 AGVKQGCMISPTLFNFYLSDLPEKLNEKYRNDI 185 >SB_24803| Best HMM Match : LRR_1 (HMM E-Value=0.0066) Length = 727 Score = 32.7 bits (71), Expect = 0.22 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PL+F++ ++D+ +T + R Sbjct: 85 VTSGVPQGTVLGPLMFLLFINDINSGITSRIR 116 >SB_21595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 32.7 bits (71), Expect = 0.22 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -3 Query: 456 AGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 AG KQGC++SP LF L D+ ++ K R + Sbjct: 74 AGVKQGCMISPTLFNFYLSDLPEKLNEKYRNDI 106 >SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 907 Score = 32.7 bits (71), Expect = 0.22 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PL+F++ ++D+ +T + R Sbjct: 713 VTSGVPQGTVLGPLMFLLFINDINSGITSRIR 744 >SB_56322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 32.7 bits (71), Expect = 0.22 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -3 Query: 456 AGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 AG KQGC++SP LF L D+ ++ K R + Sbjct: 46 AGVKQGCMISPTLFNFYLSDLPEKLNEKYRNDI 78 >SB_52166| Best HMM Match : Exo_endo_phos (HMM E-Value=5.6e-10) Length = 805 Score = 32.7 bits (71), Expect = 0.22 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PL+F++ ++D+ +T + R Sbjct: 611 VTSGVPQGTVLGPLMFLLFINDINSGITSRIR 642 >SB_50593| Best HMM Match : KIX (HMM E-Value=8) Length = 139 Score = 32.7 bits (71), Expect = 0.22 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -3 Query: 456 AGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 AG KQGC++SP LF L D+ ++ K R + Sbjct: 74 AGVKQGCMISPTLFNFYLSDLPEKLNEKYRNDI 106 >SB_47325| Best HMM Match : RVT_1 (HMM E-Value=2.2e-31) Length = 300 Score = 32.7 bits (71), Expect = 0.22 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -3 Query: 456 AGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 AG KQGC++SP LF L D+ ++ K R + Sbjct: 153 AGVKQGCMISPTLFNFYLSDLPEKLNEKYRNDI 185 >SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1230 Score = 32.7 bits (71), Expect = 0.22 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PL+F++ ++D+ +T + R Sbjct: 1082 VTSGVPQGTVLGPLMFLLFINDINSGITSRIR 1113 >SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28) Length = 591 Score = 32.7 bits (71), Expect = 0.22 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PL+F++ ++D+ +T + R Sbjct: 202 VTSGVPQGTVLGPLMFLLFINDINSGITSRIR 233 >SB_36989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 989 Score = 32.3 bits (70), Expect = 0.29 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 459 TAGAKQGCLLSPLLFIVVLDD 397 T G KQGC+LSP LF + L D Sbjct: 356 TVGVKQGCILSPTLFNIFLHD 376 >SB_13612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 32.3 bits (70), Expect = 0.29 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -3 Query: 456 AGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 AG KQGC++SP LF L D+ ++ K R + Sbjct: 46 AGVKQGCMISPTLFNFYLSDLPEKLNEKHRNDI 78 >SB_5302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 32.3 bits (70), Expect = 0.29 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPW 352 D+ V GA QG +LS LFIVVL+ ++ R G PW Sbjct: 689 DSFKVQVGAHQGSVLSLFLFIVVLE----ALSADFRSGCPW 725 >SB_42513| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) Length = 519 Score = 32.3 bits (70), Expect = 0.29 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 459 TAGAKQGCLLSPLLFIVVLDD 397 T G KQGC+LSP LF + L D Sbjct: 325 TVGVKQGCILSPTLFNIFLHD 345 >SB_32833| Best HMM Match : RVT_1 (HMM E-Value=2) Length = 317 Score = 32.3 bits (70), Expect = 0.29 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPW 352 D+ V GA QG +LS LFIVVL+ ++ R G PW Sbjct: 257 DSFKVQVGAHQGSVLSLFLFIVVLE----ALSADFRSGCPW 293 >SB_28083| Best HMM Match : Uso1_p115_C (HMM E-Value=5.7) Length = 307 Score = 32.3 bits (70), Expect = 0.29 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC +S +F++V+D ++RR K G+ Sbjct: 273 IKMGIKQGCNMSGFMFLLVMDWILRRSDGKGESGM 307 >SB_21258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 461 Score = 32.3 bits (70), Expect = 0.29 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -3 Query: 456 AGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 AG KQGC++SP LF L D+ ++ K R + Sbjct: 130 AGVKQGCMISPTLFNFYLSDLPEKLNEKHRNDI 162 >SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 31.9 bits (69), Expect = 0.39 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVT 379 D+ +TAG QG +L PL+FI+ ++D+ V+ Sbjct: 62 DSQPITAGVPQGSILGPLMFILFINDLPLEVS 93 >SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 291 Score = 31.9 bits (69), Expect = 0.39 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVT 379 D+ +TAG QG +L PL+FI+ ++D+ V+ Sbjct: 227 DSQPITAGVPQGSILGPLMFILFINDLPLEVS 258 >SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 31.9 bits (69), Expect = 0.39 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVT 379 D+ +TAG QG +L PL+FI+ ++D+ V+ Sbjct: 227 DSQPITAGVPQGSILGPLMFILFINDLPLEVS 258 >SB_11072| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 228 Score = 31.9 bits (69), Expect = 0.39 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVT 379 D+ +TAG QG +L PL+FI+ ++D+ V+ Sbjct: 15 DSQPITAGVPQGSILGPLMFILFINDLPLEVS 46 >SB_9950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 31.9 bits (69), Expect = 0.39 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVT 379 D+ +TAG QG +L PL+FI+ ++D+ V+ Sbjct: 148 DSQPITAGVPQGSILGPLMFILFINDLPLEVS 179 >SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 323 Score = 31.9 bits (69), Expect = 0.39 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVT 379 D+ +TAG QG +L PL+FI+ ++D+ V+ Sbjct: 41 DSQPITAGVPQGSILGPLMFILFINDLPLEVS 72 >SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 377 Score = 31.9 bits (69), Expect = 0.39 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVT 379 D+ +TAG QG +L PL+FI+ ++D+ V+ Sbjct: 313 DSQPITAGVPQGSILGPLMFILFINDLPLEVS 344 >SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 789 Score = 31.9 bits (69), Expect = 0.39 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVT 379 D+ +TAG QG +L PL+FI+ ++D+ V+ Sbjct: 641 DSQPITAGVPQGSILGPLMFILFINDLPLEVS 672 >SB_53026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 31.9 bits (69), Expect = 0.39 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G +G +L PL+F++ ++D+ + C R Sbjct: 17 VTSGVPKGTVLGPLMFLLFINDMQENLECTLR 48 >SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) Length = 407 Score = 31.9 bits (69), Expect = 0.39 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVT 379 D+ +TAG QG +L PL+FI+ ++D+ V+ Sbjct: 227 DSQPITAGVPQGSILGPLMFILFINDLPLEVS 258 >SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) Length = 309 Score = 31.9 bits (69), Expect = 0.39 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVT 379 D+ +TAG QG +L PL+FI+ ++D+ V+ Sbjct: 62 DSQPITAGVPQGSILGPLMFILFINDLPLEVS 93 >SB_20131| Best HMM Match : RVT_1 (HMM E-Value=0.0049) Length = 186 Score = 31.9 bits (69), Expect = 0.39 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 ++VT+G QG ++ PLLF++ ++D+ + K R Sbjct: 82 VIVTSGVPQGSVVGPLLFLLYINDLPDGINGKIR 115 >SB_59615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 752 Score = 31.5 bits (68), Expect = 0.51 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRR 385 + G QG L P+LF V++DD+MR+ Sbjct: 496 INGGIPQGTKLGPILFTVMVDDLMRK 521 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 31.5 bits (68), Expect = 0.51 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = -3 Query: 480 PLDNIVVTAGAKQGCLLSPLLFIVVLDDVM 391 P+++ ++ G KQGC+L+P+LF + V+ Sbjct: 63 PVESFSISNGVKQGCVLAPVLFNLFFTQVL 92 >SB_57033| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 686 Score = 31.5 bits (68), Expect = 0.51 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = -3 Query: 480 PLDNIVVTAGAKQGCLLSPLLFIVVLDDVM 391 P+++ ++ G KQGC+L+P+LF + V+ Sbjct: 250 PVESFSISNGVKQGCVLAPVLFNLFFTQVL 279 >SB_46731| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) Length = 519 Score = 31.5 bits (68), Expect = 0.51 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLPW 352 + G KQGC +S +F++V+D ++R G+ W Sbjct: 415 IKMGVKQGCNMSGFMFLLVMDWILRWSVGNGENGIRW 451 >SB_21468| Best HMM Match : RVT_1 (HMM E-Value=1.2) Length = 368 Score = 31.5 bits (68), Expect = 0.51 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRR 385 + G KQGC +S +F++V+D ++RR Sbjct: 318 IKTGVKQGCNMSGFMFLLVMDWILRR 343 >SB_30009| Best HMM Match : RVT_1 (HMM E-Value=1.2e-18) Length = 552 Score = 31.1 bits (67), Expect = 0.68 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVT 379 +TAG QG +L PL+FI+ ++D+ V+ Sbjct: 268 ITAGVPQGSILGPLMFILFINDLPLEVS 295 >SB_28319| Best HMM Match : zf-C2H2 (HMM E-Value=0.012) Length = 179 Score = 31.1 bits (67), Expect = 0.68 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDVMRRVTCKC 370 G KQGC LSP LF + ++D+ + C Sbjct: 24 GVKQGCSLSPTLFNIFINDIPEIFSSSC 51 >SB_23239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 31.1 bits (67), Expect = 0.68 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +3 Query: 477 MGKIMLEMYWKHAPLTCRNFMELVRRGYYNNTKF 578 +G+I +E+ AP++ NF+ V GYY T+F Sbjct: 32 LGEIEIELDADKAPISTANFLAYVDSGYYAGTQF 65 >SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2529 Score = 31.1 bits (67), Expect = 0.68 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 3/34 (8%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDVMRR---VTC 376 + VT+G QG +L P LF+V ++D++ + VTC Sbjct: 1313 VPVTSGVPQGTVLGPTLFLVFINDIVDQCSSVTC 1346 >SB_27212| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 256 Score = 31.1 bits (67), Expect = 0.68 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 +T G KQGC+L+P LF + ++R +G+ Sbjct: 22 ITIGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 56 >SB_53252| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 366 Score = 30.7 bits (66), Expect = 0.90 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKC 370 VT+G QG +L P+LF++ +D+ V C C Sbjct: 173 VTSGVPQGSILGPILFVLFANDLPDSV-CSC 202 >SB_39712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 30.7 bits (66), Expect = 0.90 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKC 370 VT+G QG +L P+LF++ +D+ V C C Sbjct: 42 VTSGVPQGSILGPILFVLFANDLPDSV-CSC 71 >SB_35875| Best HMM Match : RVT_1 (HMM E-Value=5.2e-24) Length = 1423 Score = 30.7 bits (66), Expect = 0.90 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKC 370 VT+G QG +L P+LF++ +D+ V C C Sbjct: 1075 VTSGVPQGSILGPILFVLFANDLPDSV-CSC 1104 >SB_35814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 953 Score = 30.7 bits (66), Expect = 0.90 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKC 370 VT+G QG +L P+LF++ +D+ V C C Sbjct: 687 VTSGVPQGSILGPILFVLFANDLPDSV-CSC 716 >SB_43443| Best HMM Match : Phage_fiber (HMM E-Value=3.8) Length = 266 Score = 30.7 bits (66), Expect = 0.90 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -3 Query: 480 PLDNIVVTAGAKQGCLLSPLLFIVVLDDVM 391 P ++ V+ G KQGC+L+P+LF + V+ Sbjct: 24 PSESFSVSNGVKQGCVLAPVLFNLFFTQVL 53 >SB_41460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1669 Score = 30.7 bits (66), Expect = 0.90 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMR 388 + G QG L P+LF V++DD+MR Sbjct: 1397 INGGIPQGTKLGPILFAVMVDDLMR 1421 >SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1410 Score = 30.7 bits (66), Expect = 0.90 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKC 370 VT+G QG +L P+LF++ +D+ V C C Sbjct: 616 VTSGVPQGSILGPILFVLFANDLPDSV-CSC 645 >SB_33259| Best HMM Match : RVT_1 (HMM E-Value=4.3e-12) Length = 303 Score = 30.7 bits (66), Expect = 0.90 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKC 370 VT+G QG +L P+LF++ +D+ V C C Sbjct: 110 VTSGVPQGSILGPILFVLFANDLPDSV-CSC 139 >SB_28157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 30.7 bits (66), Expect = 0.90 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = -3 Query: 465 VVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 +VT+G QG ++ PLLF++ ++D+ + K R Sbjct: 484 IVTSGVPQGSVVGPLLFLLYINDLPDGINGKIR 516 >SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 968 Score = 30.7 bits (66), Expect = 0.90 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKC 370 VT+G QG +L P+LF++ +D+ V C C Sbjct: 661 VTSGVPQGSILGPILFVLFANDLPDSV-CSC 690 >SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1821 Score = 30.7 bits (66), Expect = 0.90 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKC 370 VT+G QG +L P+LF++ +D+ V C C Sbjct: 564 VTSGVPQGSILGPILFVLFANDLPDSV-CSC 593 >SB_19684| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 617 Score = 30.7 bits (66), Expect = 0.90 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKC 370 VT+G QG +L P+LF++ +D+ V C C Sbjct: 424 VTSGVPQGSILGPILFVLFANDLPDSV-CSC 453 >SB_55435| Best HMM Match : RVT_1 (HMM E-Value=7.9e-22) Length = 726 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDV 394 G KQGC+LSP LF + L D+ Sbjct: 527 GVKQGCMLSPTLFNLFLSDL 546 >SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1402 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDV 394 I VT+G QG +L PL+F++ ++D+ Sbjct: 663 ISVTSGVPQGTVLGPLMFLLYINDI 687 >SB_51188| Best HMM Match : RVT_1 (HMM E-Value=4.5e-24) Length = 505 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDV 394 G KQGC+LSP LF + L D+ Sbjct: 113 GVKQGCMLSPTLFNLFLSDL 132 >SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) Length = 314 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDVM 391 + VT+G QG +L P LF+V ++D++ Sbjct: 110 VPVTSGVPQGTVLGPTLFLVFINDIV 135 >SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1858 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDV 394 G KQGC+LSP LF + L D+ Sbjct: 1479 GVKQGCMLSPTLFNLFLSDL 1498 >SB_40223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -3 Query: 480 PLDNIVVTAGAKQGCLLSPLLFIVVLDDVM 391 P ++ ++ G KQGC+L+P+LF + V+ Sbjct: 193 PSESFSISNGVKQGCVLAPVLFNLFFTQVL 222 >SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 931 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDVM 391 + VT+G QG +L P LF+V ++D++ Sbjct: 587 VPVTSGVPQGTVLGPTLFLVFINDIV 612 >SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) Length = 1799 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -1 Query: 284 SSTDSAPMSIKGRHIEQVGSFCYLGSIVDDR 192 S+ DS + IKG +++V F YLG + D+R Sbjct: 1564 SNVDSFSIVIKGSTVKRVAEFKYLGVVFDER 1594 >SB_31085| Best HMM Match : RVT_1 (HMM E-Value=0.0094) Length = 270 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L P+LF V ++D+ + + R Sbjct: 90 VTSGVPQGTVLGPVLFNVFINDIQESIRSEIR 121 >SB_29894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDV 394 G KQGC+LSP LF + L D+ Sbjct: 436 GVKQGCMLSPTLFNLFLSDL 455 >SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 411 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDVM 391 + VT+G QG +L P LF+V ++D++ Sbjct: 195 VPVTSGVPQGTVLGPTLFLVFINDIV 220 >SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) Length = 277 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVT 379 D+ +TAG +G +L PL+FI+ ++D+ V+ Sbjct: 62 DSQPITAGVPRGSILGPLMFILFINDLPLEVS 93 >SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3669 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -3 Query: 480 PLDNIVVTAGAKQGCLLSPLLFIVVLDDVM 391 P ++ ++ G KQGC+L+P+LF + V+ Sbjct: 3015 PSESFSISNGVKQGCVLAPVLFNLFFTQVL 3044 >SB_45895| Best HMM Match : RVT_1 (HMM E-Value=0.00031) Length = 313 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDV 394 G KQGC+LSP LF + L D+ Sbjct: 233 GVKQGCMLSPTLFNLFLSDL 252 >SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) Length = 2386 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDVM 391 + VT+G QG +L P LF+V ++D++ Sbjct: 193 VPVTSGVPQGTVLGPTLFLVFINDIV 218 >SB_40728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1317 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDV 394 G KQGC+LSP LF + L D+ Sbjct: 1199 GVKQGCMLSPTLFNLFLSDL 1218 >SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2124 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDVM 391 + VT+G QG +L P LF+V ++D++ Sbjct: 1977 VPVTSGVPQGTVLGPTLFLVFINDIV 2002 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDVM 391 + VT+G QG +L P LF+V ++D++ Sbjct: 297 VPVTSGVPQGTVLGPTLFLVFINDIV 322 >SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) Length = 409 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDVM 391 + VT+G QG +L P LF+V ++D++ Sbjct: 110 VPVTSGVPQGTVLGPTLFLVFINDIV 135 >SB_27722| Best HMM Match : RVT_1 (HMM E-Value=0.00011) Length = 315 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDV 394 G KQGC+LSP LF + L D+ Sbjct: 235 GVKQGCMLSPTLFNLFLSDL 254 >SB_26566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1141 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDV 394 G KQGC+LSP LF + L D+ Sbjct: 462 GVKQGCMLSPTLFNLFLSDL 481 >SB_22389| Best HMM Match : RVT_1 (HMM E-Value=1.6e-37) Length = 458 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDV 394 G KQGC+LSP LF + L D+ Sbjct: 235 GVKQGCMLSPTLFNLFLSDL 254 >SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDVM 391 + VT+G QG +L P LF+V ++D++ Sbjct: 187 VPVTSGVPQGTVLGPTLFLVFINDIV 212 >SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDVM 391 + VT+G QG +L P LF+V ++D++ Sbjct: 265 VPVTSGVPQGTVLGPTLFLVFINDIV 290 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDVM 391 + VT+G QG +L P LF+V ++D++ Sbjct: 326 VPVTSGVPQGTVLGPTLFLVFINDIV 351 >SB_6541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -3 Query: 480 PLDNIVVTAGAKQGCLLSPLLFIVVLDDVM 391 P ++ ++ G KQGC+L+P+LF + V+ Sbjct: 442 PSESFSISNGVKQGCVLAPVLFNLFFTQVL 471 >SB_3959| Best HMM Match : RVT_1 (HMM E-Value=6.4e-40) Length = 380 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -3 Query: 480 PLDNIVVTAGAKQGCLLSPLLFIVVLDDVM 391 P ++ ++ G KQGC+L+P+LF + V+ Sbjct: 193 PSESFSISNGVKQGCVLAPVLFNLFFTQVL 222 >SB_962| Best HMM Match : RVT_1 (HMM E-Value=2.5e-36) Length = 1195 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -3 Query: 480 PLDNIVVTAGAKQGCLLSPLLFIVVLDDVM 391 P ++ ++ G KQGC+L+P+LF + V+ Sbjct: 785 PSESFSISNGVKQGCVLAPVLFNLFFTQVL 814 >SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) Length = 565 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PLLF++ ++D+ ++ R Sbjct: 257 VTSGVPQGTVLGPLLFLLFVNDLPLNISSTIR 288 >SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 670 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PLLF++ ++D+ ++ R Sbjct: 257 VTSGVPQGTVLGPLLFLLFVNDLPLNISSTIR 288 >SB_51225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDVM 391 + VT+G QG +L P LF+V + D++ Sbjct: 3 VPVTSGVPQGTVLGPTLFLVFISDIV 28 >SB_45791| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.2) Length = 304 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDV 394 VT+G QG +L PLLF+V +D+ Sbjct: 270 VTSGVPQGSILGPLLFLVYANDM 292 >SB_42960| Best HMM Match : RVT_1 (HMM E-Value=2.38221e-44) Length = 455 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PLLF++ ++D+ ++ R Sbjct: 147 VTSGVPQGTVLGPLLFLLFVNDLPLNISSTIR 178 >SB_40804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1044 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG ++ PLLF++ ++D+ +T R Sbjct: 807 VTSGVPQGSVVRPLLFLLFINDLPEGITGNIR 838 >SB_27537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 396 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PLLF++ ++D+ ++ R Sbjct: 88 VTSGVPQGTVLGPLLFLLFVNDLPLNISSTIR 119 >SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 668 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PLLF++ ++D+ ++ R Sbjct: 360 VTSGVPQGTVLGPLLFLLFVNDLPLNISSTIR 391 >SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1126 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PLLF++ ++D+ ++ R Sbjct: 818 VTSGVPQGTVLGPLLFLLFVNDLPLNISSTIR 849 >SB_58057| Best HMM Match : RVT_1 (HMM E-Value=0.0085) Length = 576 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/35 (45%), Positives = 24/35 (68%), Gaps = 5/35 (14%) Frame = -3 Query: 462 VTAGAKQGCLLSP----LLFIVVLDDVMRRVT-CK 373 V+ G KQGC+L+P LLF +L DV++ ++ CK Sbjct: 268 VSNGVKQGCVLAPTLFSLLFSAMLTDVLKMMSACK 302 >SB_45340| Best HMM Match : RVT_1 (HMM E-Value=1.2e-15) Length = 447 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PLLF++ ++D+ ++ R Sbjct: 139 VTSGVPQGTVLGPLLFLLFVNDLPLNISSTIR 170 >SB_38334| Best HMM Match : RVT_1 (HMM E-Value=5.60519e-45) Length = 435 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PLLF++ ++D+ ++ R Sbjct: 257 VTSGVPQGTVLGPLLFLLFVNDLPLNISSTIR 288 >SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) Length = 1061 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PLLF++ ++D+ ++ R Sbjct: 753 VTSGVPQGTVLGPLLFLLFVNDLPLNISSTIR 784 >SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 719 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = -3 Query: 465 VVTAGAKQGCLLSPLLFIVVLDDV 394 +VT+G QG +L PLLF++ ++D+ Sbjct: 477 LVTSGVPQGTVLGPLLFLLYMNDL 500 >SB_27764| Best HMM Match : RVT_1 (HMM E-Value=3.99931e-42) Length = 715 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDV 394 VT+G QG +L PLLF+V +D+ Sbjct: 619 VTSGVPQGSILGPLLFLVYANDM 641 >SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14) Length = 832 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PLLF++ ++D+ ++ R Sbjct: 524 VTSGVPQGTVLGPLLFLLFVNDLPLNISSTIR 555 >SB_25119| Best HMM Match : Ribosomal_S27 (HMM E-Value=9.4) Length = 443 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 D + VT+G QG L P LF++ ++D+ + + R Sbjct: 13 DKVQVTSGVPQGFELGPTLFLLYINDICKASNSQIR 48 >SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 913 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L PLLF++ ++D+ ++ R Sbjct: 815 VTSGVPQGTVLGPLLFLLFVNDLPLNISSTIR 846 >SB_24072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 822 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDV 394 VT+G QG +L PLLF+V +D+ Sbjct: 613 VTSGVPQGSILGPLLFLVYANDM 635 >SB_15469| Best HMM Match : RVT_1 (HMM E-Value=0.00014) Length = 709 Score = 29.9 bits (64), Expect = 1.6 Identities = 23/54 (42%), Positives = 31/54 (57%) Frame = -3 Query: 525 MSKVHVSNTFPT*FFPLDNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQ 364 MS V V+N T FFPL KQG +SP LFI+VL +VM + +C++ Sbjct: 620 MSAV-VNNGHCTDFFPLGR-----STKQGDPISPYLFILVL-EVMATMIRECKE 666 >SB_7145| Best HMM Match : RVT_1 (HMM E-Value=3.8e-25) Length = 455 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDV 394 VT+G QG +L PLLF+V +D+ Sbjct: 275 VTSGVAQGSILGPLLFLVYANDM 297 >SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022) Length = 270 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVT 379 D+ +TAG Q +L PL+FI+ ++D+ V+ Sbjct: 75 DSQPITAGVPQSSILGPLMFILFINDLPLEVS 106 >SB_58643| Best HMM Match : RhoGAP (HMM E-Value=3.7) Length = 295 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDVMR 388 G QG LSP+LF V++DD++R Sbjct: 21 GIPQGTKLSPILFAVMVDDLVR 42 >SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1462 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDV 394 V +G QG LL PLLF+V ++D+ Sbjct: 706 VLSGVPQGSLLGPLLFLVYINDL 728 >SB_50566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 V+ G KQGC+L+P LF + L ++ C G+ Sbjct: 80 VSNGVKQGCVLAPTLFSLYLSAMLEIAFKDCVDGV 114 >SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1273 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = -3 Query: 465 VVTAGAKQGCLLSPLLFIVVLDDV 394 +VT+G QG +L PLLF++ ++D+ Sbjct: 763 LVTSGVPQGTVLGPLLFLLYVNDL 786 >SB_37794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 750 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDVMR 388 G QG LSP+LF V++DD++R Sbjct: 497 GIPQGTKLSPILFAVMVDDLVR 518 >SB_34933| Best HMM Match : RVT_1 (HMM E-Value=3.5e-08) Length = 390 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDVMR 388 G QG LSP+LF V++DD++R Sbjct: 116 GIPQGTKLSPILFAVMVDDLVR 137 >SB_33707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 456 AGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 AG KQGC++S LF L D+ ++ K R + Sbjct: 179 AGVKQGCMISTTLFNFYLSDLPEKLNEKYRNDI 211 >SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11) Length = 809 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 474 DNIVVTAGAKQGCLLSPLLFIVVLDDVMRRVT 379 D+ +TAG Q +L PL+FI+ ++D+ V+ Sbjct: 287 DSQPITAGVPQSSILGPLMFILFINDLPLEVS 318 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 29.5 bits (63), Expect = 2.1 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -3 Query: 480 PLDNIVVTAGAKQGCLLSPLLF 415 P ++ ++ G KQGC+L+P+LF Sbjct: 603 PSESFSISNGVKQGCVLAPVLF 624 >SB_31784| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 963 Score = 29.5 bits (63), Expect = 2.1 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -3 Query: 480 PLDNIVVTAGAKQGCLLSPLLF 415 P ++ ++ G KQGC+L+P+LF Sbjct: 617 PSESFSISNGVKQGCVLAPVLF 638 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = -3 Query: 465 VVTAGAKQGCLLSPLLFIVVLDDV 394 +VT+G QG +L PLLF++ ++D+ Sbjct: 69 LVTSGVPQGTVLGPLLFLLYVNDL 92 >SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1360 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 V +G QG +LSP+LF++ ++D+ + R Sbjct: 668 VVSGVPQGSVLSPVLFLLFINDISTSIQSNLR 699 >SB_20480| Best HMM Match : RVT_1 (HMM E-Value=0.00014) Length = 332 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 V+ G KQGC+L+P LF + L ++ C G+ Sbjct: 180 VSNGVKQGCVLAPTLFSLYLSAMLEIAFKDCVDGV 214 >SB_19328| Best HMM Match : RVT_1 (HMM E-Value=2e-36) Length = 295 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = -3 Query: 465 VVTAGAKQGCLLSPLLFIVVLDDV 394 +VT+G QG +L PLLF++ ++D+ Sbjct: 165 LVTSGVPQGTVLGPLLFLLYVNDL 188 >SB_7036| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6) Length = 268 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 V+ G KQGC+L+P LF + L ++ C G+ Sbjct: 62 VSNGVKQGCVLAPTLFSLYLSAMLEIAFKDCVDGV 96 >SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 943 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDV 394 V +G QG LL PLLF+V ++D+ Sbjct: 297 VLSGVPQGSLLGPLLFLVYINDL 319 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = -3 Query: 465 VVTAGAKQGCLLSPLLFIVVLDDV 394 +VT+G QG +L PLLF++ ++D+ Sbjct: 301 LVTSGVPQGTVLGPLLFLLYVNDL 324 >SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 864 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = -3 Query: 465 VVTAGAKQGCLLSPLLFIVVLDDV 394 +VT+G QG +L PLLF++ ++D+ Sbjct: 485 LVTSGVPQGTVLGPLLFLLYVNDL 508 >SB_55944| Best HMM Match : RVT_1 (HMM E-Value=1.6e-11) Length = 387 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDVMR 388 G QG LSP+LF V++DD++R Sbjct: 113 GIPQGTKLSPILFAVMVDDLVR 134 >SB_54400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 723 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L P+LF + ++D+ V + R Sbjct: 606 VTSGVPQGTVLGPVLFNLFINDIQESVRSEIR 637 >SB_50273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDV 394 V +G QG LL PLLF+V ++D+ Sbjct: 175 VLSGVPQGSLLGPLLFLVYINDL 197 >SB_50090| Best HMM Match : SPC22 (HMM E-Value=2.8) Length = 268 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 V+ G KQGC+L+P LF + L ++ C G+ Sbjct: 62 VSNGVKQGCVLAPTLFSLYLSAMLEIAFKDCVDGV 96 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC+L+P LF + ++R +G+ Sbjct: 2236 INTGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 2270 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = -3 Query: 465 VVTAGAKQGCLLSPLLFIVVLDDV 394 +VT+G QG +L PLLF++ ++D+ Sbjct: 275 LVTSGVPQGTVLGPLLFLLYVNDL 298 >SB_42434| Best HMM Match : RVT_1 (HMM E-Value=2.7e-18) Length = 418 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 456 AGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 AG KQGC++S LF L D+ ++ K R + Sbjct: 179 AGVKQGCMISTTLFNFYLSDLPEKLNEKYRNDI 211 >SB_41552| Best HMM Match : RVT_1 (HMM E-Value=5.4e-32) Length = 1241 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = -3 Query: 465 VVTAGAKQGCLLSPLLFIVVLDDV 394 +VT+G QG +L PLLF++ ++D+ Sbjct: 641 LVTSGVPQGTVLGPLLFLLYVNDL 664 >SB_31122| Best HMM Match : RVT_1 (HMM E-Value=0.0033) Length = 324 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 ++ G KQGC+L+P LF + ++R +G+ Sbjct: 173 ISIGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 207 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVL 403 ++ G KQGC+L+P LF ++L Sbjct: 113 ISIGVKQGCVLAPTLFNILL 132 >SB_29550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 464 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 V+ G KQGC+L+P LF + L ++ C G+ Sbjct: 171 VSNGVKQGCVLAPTLFSLYLSAMLEVAFKDCVDGV 205 >SB_23136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDVMR 388 G QG LSP+LF V++DD++R Sbjct: 21 GIPQGTKLSPILFAVMVDDLVR 42 >SB_21992| Best HMM Match : LRR_1 (HMM E-Value=3.2e-07) Length = 534 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L P+LF + ++D+ V + R Sbjct: 438 VTSGVPQGTVLGPVLFNLFINDIQESVQSEIR 469 >SB_21912| Best HMM Match : RhoGAP (HMM E-Value=3.7) Length = 238 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDVMR 388 G QG LSP+LF V++DD++R Sbjct: 21 GIPQGTKLSPILFAVMVDDLVR 42 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = -3 Query: 465 VVTAGAKQGCLLSPLLFIVVLDDV 394 +VT+G QG +L PLLF++ ++D+ Sbjct: 360 LVTSGVPQGTVLGPLLFLLYVNDL 383 >SB_19159| Best HMM Match : RVT_1 (HMM E-Value=0.00032) Length = 426 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 V+ G KQGC+L+P LF + L ++ C G+ Sbjct: 130 VSNGVKQGCVLAPTLFSLYLSAMLEIAFKDCVDGV 164 >SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 546 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = -3 Query: 465 VVTAGAKQGCLLSPLLFIVVLDDV 394 +VT+G QG +L PLLF++ ++D+ Sbjct: 293 LVTSGVPQGTVLGPLLFLLYVNDL 316 >SB_18732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) Length = 1582 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 V+ G KQGC+L+P LF + L ++ C G+ Sbjct: 1289 VSNGVKQGCVLAPTLFSLYLSAMLEIAFKDCVDGV 1323 >SB_12628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1163 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDVMR 388 G QG LSP+LF V++DD++R Sbjct: 889 GIPQGTKLSPILFAVMVDDLVR 910 >SB_11213| Best HMM Match : RVT_1 (HMM E-Value=6.4e-38) Length = 510 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L P+LF + ++D+ V + R Sbjct: 240 VTSGVPQGTVLGPVLFNLFINDIQESVRSEIR 271 >SB_10602| Best HMM Match : RVT_1 (HMM E-Value=1.3e-10) Length = 416 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 V+ G KQGC+L+P LF + L ++ C G+ Sbjct: 224 VSNGVKQGCVLAPTLFSLYLSAMLEIAFKDCVDGV 258 >SB_6740| Best HMM Match : RVT_1 (HMM E-Value=4.5e-22) Length = 884 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDVMR 388 G QG LSP+LF V++DD++R Sbjct: 681 GIPQGTKLSPILFAVMVDDLVR 702 >SB_5957| Best HMM Match : Chitin_synth_1 (HMM E-Value=9) Length = 416 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L P+LF + ++D+ V + R Sbjct: 372 VTSGVPQGTVLGPVLFNLFINDIQESVRSEIR 403 >SB_3856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 V+ G KQGC+L+P LF + L ++ C G+ Sbjct: 169 VSNGVKQGCVLAPTLFSLYLSAMLEIAFKDCVDGV 203 >SB_2811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 744 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDVMR 388 G QG LSP+LF V++DD++R Sbjct: 470 GIPQGTKLSPILFAVMVDDLVR 491 >SB_267| Best HMM Match : RhoGAP (HMM E-Value=3.7) Length = 284 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDVMR 388 G QG LSP+LF V++DD++R Sbjct: 10 GIPQGTKLSPILFAVMVDDLVR 31 >SB_51570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1950 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC+L+P LF + ++R +G+ Sbjct: 176 INIGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 210 >SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) Length = 677 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC+L+P LF + ++R +G+ Sbjct: 316 INIGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 350 >SB_36682| Best HMM Match : RVT_1 (HMM E-Value=0.0067) Length = 308 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC+L+P LF + ++R +G+ Sbjct: 78 INIGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 112 >SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) Length = 530 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC+L+P LF + ++R +G+ Sbjct: 148 INIGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 182 >SB_32869| Best HMM Match : Toxin_7 (HMM E-Value=3.9) Length = 910 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDVMRRV-TC 376 G KQGC+LSP LF + D+ ++ TC Sbjct: 24 GVKQGCMLSPTLFNLYAHDLPEQLDTC 50 >SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) Length = 590 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC+L+P LF + ++R +G+ Sbjct: 356 INIGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 390 >SB_29603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDVMRRVTCKC 370 G K+GC LSP LF + ++D+ + C Sbjct: 24 GVKRGCNLSPTLFNIFINDIPEIFSSSC 51 >SB_25070| Best HMM Match : RVT_1 (HMM E-Value=1.4e-15) Length = 385 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC+L+P LF + ++R +G+ Sbjct: 111 INIGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 145 >SB_21953| Best HMM Match : UME (HMM E-Value=6.1) Length = 304 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = -3 Query: 453 GAKQGCLLSPLLFIVVLDDVMRRV-TC 376 G KQGC+LSP LF + D+ ++ TC Sbjct: 24 GVKQGCMLSPTLFNLYAHDLPEQLDTC 50 >SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 361 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDV 394 VT+G QG +L PLLF++ ++D+ Sbjct: 56 VTSGVPQGTVLGPLLFLLYVNDL 78 >SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) Length = 661 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC+L+P LF + ++R +G+ Sbjct: 310 INIGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 344 >SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC+L+P LF + ++R +G+ Sbjct: 28 INIGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 62 >SB_56675| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-08) Length = 545 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC+L+P LF + ++R +G+ Sbjct: 508 INIGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 542 >SB_55170| Best HMM Match : RVT_1 (HMM E-Value=0.16) Length = 216 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC+L+P LF + ++R +G+ Sbjct: 111 INIGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 145 >SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 792 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDV 394 VT G QG +L PLLF+V +D+ Sbjct: 476 VTLGVPQGSILGPLLFLVYANDM 498 >SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) Length = 458 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC+L+P LF + ++R +G+ Sbjct: 145 INIGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 179 >SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC+L+P LF + ++R +G+ Sbjct: 438 INIGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 472 >SB_41699| Best HMM Match : RVT_1 (HMM E-Value=1.90002e-41) Length = 352 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC+L+P LF + ++R +G+ Sbjct: 201 INIGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 235 >SB_39321| Best HMM Match : RVT_1 (HMM E-Value=4.5e-39) Length = 900 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDV 394 VT+G QG +L PLLF++ ++D+ Sbjct: 592 VTSGVPQGTVLGPLLFLLFVNDL 614 >SB_36757| Best HMM Match : RVT_1 (HMM E-Value=4.1e-28) Length = 381 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC+L+P LF + ++R +G+ Sbjct: 271 INIGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 305 >SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 416 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC+L+P LF + ++R +G+ Sbjct: 34 INIGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 68 >SB_12357| Best HMM Match : RVT_1 (HMM E-Value=7.69999e-41) Length = 889 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC+L+P LF + ++R +G+ Sbjct: 712 INIGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 746 >SB_3152| Best HMM Match : RVT_1 (HMM E-Value=5.4006e-42) Length = 717 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC+L+P LF + ++R +G+ Sbjct: 500 INIGVKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 534 >SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15) Length = 291 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDV 394 + VT+G QG +L P LF++ ++D+ Sbjct: 110 VPVTSGVPQGTVLGPTLFLLFINDI 134 >SB_56299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 447 KQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 KQGC++SP LF L D+ ++ K R + Sbjct: 3 KQGCMISPTLFNFYLSDLPEKLNEKYRNDI 32 >SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) Length = 453 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDV 394 + VT+G QG +L P LF++ ++D+ Sbjct: 141 VPVTSGVPQGTVLGPTLFLLFINDI 165 >SB_52531| Best HMM Match : RVT_1 (HMM E-Value=1e-08) Length = 309 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 296 QPIGSSTDSAP-MSIKGRHIEQVGSFCYLGSIVDD 195 QP ST P ++I G ++ V SF YLGS + + Sbjct: 215 QPAPDSTPQQPCITIDGTQLKNVDSFVYLGSTISN 249 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -3 Query: 480 PLDNIVVTAGAKQGCLLSPLLFIVVLDDVM 391 P ++ ++ G KQ C+L+P+LF + V+ Sbjct: 101 PSESFSISNGVKQACVLAPVLFNLFFTQVL 130 >SB_40620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDV 394 + VT+G QG +L P LF++ ++D+ Sbjct: 12 VPVTSGVPQGTVLGPTLFLLFINDI 36 >SB_37487| Best HMM Match : RVT_1 (HMM E-Value=0.03) Length = 347 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDV 394 + VT+G QG +L P LF++ ++D+ Sbjct: 212 VPVTSGVPQGTVLGPTLFLLFINDI 236 >SB_36818| Best HMM Match : RVT_1 (HMM E-Value=8e-35) Length = 629 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 296 QPIGSSTDSAP-MSIKGRHIEQVGSFCYLGSIVDD 195 QP ST P ++I G ++ V SF YLGS + + Sbjct: 403 QPAPDSTPQQPCITIDGTQLKNVDSFVYLGSTISN 437 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -3 Query: 480 PLDNIVVTAGAKQGCLLSPLLFIVVLDDVM 391 P ++ ++ G KQ C+L+P+LF + V+ Sbjct: 289 PSESFSISNGVKQACVLAPVLFNLFFTQVL 318 >SB_35764| Best HMM Match : RVT_1 (HMM E-Value=8.1e-13) Length = 362 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDV 394 VT+G QG LL P+LF++ +D+ Sbjct: 184 VTSGVPQGSLLGPILFLLYANDL 206 >SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 522 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDV 394 + VT+G QG +L P LF++ ++D+ Sbjct: 210 VPVTSGVPQGTVLGPTLFLLFINDI 234 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDV 394 + VT+G QG +L P LF++ ++D+ Sbjct: 1028 VPVTSGVPQGTVLGPTLFLLFINDI 1052 Score = 28.3 bits (60), Expect = 4.8 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDV 394 + VT+G QG +L P LF++ + D+ Sbjct: 1220 VPVTSGVPQGTVLGPTLFLLYISDI 1244 >SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) Length = 892 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDV 394 + VT+G QG +L P LF++ ++D+ Sbjct: 580 VPVTSGVPQGTVLGPTLFLLFINDI 604 >SB_25600| Best HMM Match : RVT_1 (HMM E-Value=0.0074) Length = 337 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 447 KQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 KQGC++SP LF L D+ ++ K R + Sbjct: 82 KQGCMISPTLFNFYLSDLPEKLNEKYRNDI 111 >SB_19870| Best HMM Match : RVT_1 (HMM E-Value=0.18) Length = 530 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVT 379 VT+G QG +L P+LF + ++D++ V+ Sbjct: 135 VTSGVSQGTVLGPVLFNLFINDIVNVVS 162 >SB_5465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 810 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = -3 Query: 465 VVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 +VT+G G ++ PLLF++ ++D+ + K R Sbjct: 692 IVTSGVPHGSVVGPLLFLLYINDLPDGINGKIR 724 >SB_59500| Best HMM Match : RVT_1 (HMM E-Value=0.015) Length = 224 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDV 394 + VT+G QG +L P LF++ ++D+ Sbjct: 160 VPVTSGVPQGTVLGPTLFLLFINDI 184 >SB_57293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1395 Score = 28.7 bits (61), Expect = 3.6 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -3 Query: 486 FFPLDNIVVTAGAKQGCLLSPLLFIVVLDDVM 391 FFP+ N G KQGC+L+P LF ++ ++ Sbjct: 752 FFPVSN-----GVKQGCVLAPTLFSLMFSAML 778 >SB_50676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDV 394 + VT+G QG +L P LF++ ++D+ Sbjct: 746 VPVTSGVPQGTVLGPTLFLLFINDI 770 >SB_45260| Best HMM Match : RVT_1 (HMM E-Value=1.2) Length = 584 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDV 394 V AG QG L P+LF+++++D+ Sbjct: 516 VNAGVPQGTKLGPILFVIMINDL 538 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 VT+G QG +L P LF++ ++D+ + R Sbjct: 973 VTSGVPQGSVLGPTLFLLFINDIAESSNSRLR 1004 >SB_27893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDV 394 VT+G QG LL P+LF++ +D+ Sbjct: 23 VTSGVPQGSLLGPILFLLYANDL 45 >SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) Length = 322 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGL 358 + G KQGC+L+P LF + ++R +G+ Sbjct: 74 INIGIKQGCVLAPTLFNIFFSVLLRHAFGSADEGI 108 >SB_23276| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDV 394 + VT+G QG +L P LF++ ++D+ Sbjct: 12 VPVTSGVPQGTVLGPTLFLLFINDI 36 >SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1176 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDV 394 + VT+G QG +L P LF++ ++D+ Sbjct: 916 VPVTSGVPQGTVLGPTLFLLFINDI 940 >SB_8130| Best HMM Match : RVT_1 (HMM E-Value=8e-35) Length = 869 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 296 QPIGSSTDSAP-MSIKGRHIEQVGSFCYLGSIVDD 195 QP ST P ++I G ++ V SF YLGS + + Sbjct: 663 QPAPDSTPQQPCITIDGTQLKNVDSFVYLGSTISN 697 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -3 Query: 480 PLDNIVVTAGAKQGCLLSPLLFIVVLDDVM 391 P ++ ++ G KQ C+L+P+LF + V+ Sbjct: 549 PSESFSISNGVKQACVLAPVLFNLFFTQVL 578 >SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36) Length = 1677 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -3 Query: 468 IVVTAGAKQGCLLSPLLFIVVLDDV 394 + VT+G QG +L P LF++ ++D+ Sbjct: 1336 VPVTSGVPQGTVLGPTLFLLFINDI 1360 >SB_59080| Best HMM Match : RVT_1 (HMM E-Value=1.2e-35) Length = 318 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLP 355 V+ G KQGC+L+P LF ++ ++ + G+P Sbjct: 152 VSNGVKQGCVLAPTLFSLMFSAMLTDAFREIPLGIP 187 >SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) Length = 419 Score = 28.3 bits (60), Expect = 4.8 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDV 394 VT+G QG +L P LF++ ++D+ Sbjct: 361 VTSGVPQGSVLGPTLFLLYINDI 383 >SB_54448| Best HMM Match : RVT_1 (HMM E-Value=0.096) Length = 343 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLP 355 V+ G KQGC+L+P LF ++ ++ + G+P Sbjct: 84 VSNGVKQGCVLAPTLFSLMFSAMLTDAFRETPLGIP 119 >SB_47691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = -3 Query: 465 VVTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCR 367 +VT+G QG ++ LLF++ ++D+ + K R Sbjct: 85 IVTSGVPQGSVVGSLLFLLYINDLPDEINGKIR 117 >SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 28.3 bits (60), Expect = 4.8 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDV 394 VT+G QG +L P LF++ ++D+ Sbjct: 527 VTSGVPQGSVLGPALFLLFINDI 549 >SB_41718| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) Length = 470 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLP 355 V+ G KQGC+L+P LF ++ ++ + G+P Sbjct: 211 VSNGVKQGCVLAPTLFSLMFSAMLTDAFRETPLGIP 246 >SB_37650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLP 355 V+ G KQGC+L+P LF ++ ++ + G+P Sbjct: 197 VSNGVKQGCVLAPTLFSLMFSAMLTDAFRETPLGIP 232 >SB_32446| Best HMM Match : RVT_1 (HMM E-Value=0.04) Length = 197 Score = 28.3 bits (60), Expect = 4.8 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDV 394 VT+G QG +L P LF++ ++D+ Sbjct: 89 VTSGVPQGSVLGPTLFLLYINDI 111 >SB_32337| Best HMM Match : CaMBD (HMM E-Value=5.9) Length = 289 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDVMRRVTCKCRQGLP 355 V+ G KQGC+L+P LF ++ ++ + G+P Sbjct: 16 VSNGVKQGCVLAPTLFSLMFSAMLTDAFRETPLGIP 51 >SB_32070| Best HMM Match : RVT_1 (HMM E-Value=2.4e-15) Length = 345 Score = 28.3 bits (60), Expect = 4.8 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -3 Query: 462 VTAGAKQGCLLSPLLFIVVLDDV 394 VT+G QG +L P LF++ ++D+ Sbjct: 199 VTSGVPQGSVLGPTLFLLYINDI 221 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,190,286 Number of Sequences: 59808 Number of extensions: 418466 Number of successful extensions: 1352 Number of sequences better than 10.0: 288 Number of HSP's better than 10.0 without gapping: 1215 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1348 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1385833362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -