BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0597 (639 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2G2.02 |syj1||inositol-polyphosphate 5-phosphatase |Schizosa... 30 0.25 SPAC1F3.01 |rrp6|SPAC3H8.11|exosome subunit Rrp6 |Schizosaccharo... 27 2.3 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 26 5.3 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 26 5.3 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 25 9.2 >SPBC2G2.02 |syj1||inositol-polyphosphate 5-phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1076 Score = 30.3 bits (65), Expect = 0.25 Identities = 16/49 (32%), Positives = 20/49 (40%) Frame = +2 Query: 371 PPPVGRHDSRVPGASSAPVRALPHAPPRTPGAHARTPAAQRAIPNRTGI 517 PP G S VP + PV P PPR A R+ + P + I Sbjct: 1022 PPRSGSSSSGVPAPNLTPVNVPPTPPPRKSSASQRSGDLLASSPEESSI 1070 >SPAC1F3.01 |rrp6|SPAC3H8.11|exosome subunit Rrp6 |Schizosaccharomyces pombe|chr 1|||Manual Length = 777 Score = 27.1 bits (57), Expect = 2.3 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = -3 Query: 367 QLMAQLPELQLGERLAGQARRNHLMTFRGIVLRRSRAQHRRPWITTT 227 QL L ELQ + +A + +FRG V + + WI T Sbjct: 226 QLSDMLKELQNSKEIAVDLEHHDYRSFRGFVCLMQISNREKDWIVDT 272 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 25.8 bits (54), Expect = 5.3 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 534 HHASYAYLYRSRAQQSPNYQHRPYSSGFVPP 626 + ++ YLY SRA+ ++ S+ FVPP Sbjct: 331 YRIAFPYLYNSRARSVALSEYHQPSNVFVPP 361 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 25.8 bits (54), Expect = 5.3 Identities = 16/46 (34%), Positives = 19/46 (41%) Frame = +2 Query: 374 PPVGRHDSRVPGASSAPVRALPHAPPRTPGAHARTPAAQRAIPNRT 511 PP GR P SAP P + A + PA AIP R+ Sbjct: 354 PPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRS 399 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 25.0 bits (52), Expect = 9.2 Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +2 Query: 371 PPPVGRHDSR-VPGASSAPVRALPHAPPRTPGAHARTPAAQRAIP 502 P P+ D+ +P S+AP +P + P P + + P+A +P Sbjct: 1023 PVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVP 1067 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,403,486 Number of Sequences: 5004 Number of extensions: 44030 Number of successful extensions: 130 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 285732116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -