BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0592 (709 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17097| Best HMM Match : F-box (HMM E-Value=3.8) 30 2.1 SB_15167| Best HMM Match : F-box (HMM E-Value=3.8) 30 2.1 >SB_17097| Best HMM Match : F-box (HMM E-Value=3.8) Length = 408 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/47 (25%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +1 Query: 571 KSFSEIVQKFHFD*FENIVEHCNYGECI-LISFQVYKSWLELKFIWP 708 KS+ ++ + + + N++ +C Y + ++S+ YKS+L + WP Sbjct: 187 KSYLNVLSYWPYKSYLNVLSYCPYKSYLNVLSYWPYKSYLNVLSYWP 233 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/47 (25%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +1 Query: 571 KSFSEIVQKFHFD*FENIVEHCNYGECI-LISFQVYKSWLELKFIWP 708 KS+ ++ + + + N++ +C Y + ++S+ YKS+L + WP Sbjct: 307 KSYLNVLSYWPYKSYLNVLSYCPYKSYLNVLSYWPYKSYLNVLSYWP 353 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/47 (25%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 571 KSFSEIVQKFHFD*FENIVEHCNYGECI-LISFQVYKSWLELKFIWP 708 KS+ ++ + + N++ +C Y + ++S+ YKS+L + WP Sbjct: 271 KSYLNVLSYCPYKSYLNVLSYCPYKSYLNVLSYWPYKSYLNVLSYWP 317 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/47 (25%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 571 KSFSEIVQKFHFD*FENIVEHCNYGECI-LISFQVYKSWLELKFIWP 708 KS+ + + + N++ +C Y + ++S+ +YKS+L + WP Sbjct: 151 KSYLNALSYCPYKSYLNVLSYCPYKSYLNVLSYWLYKSYLNVLSYWP 197 >SB_15167| Best HMM Match : F-box (HMM E-Value=3.8) Length = 392 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/47 (25%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +1 Query: 571 KSFSEIVQKFHFD*FENIVEHCNYGECI-LISFQVYKSWLELKFIWP 708 KS+ ++ + + + N++ +C Y + ++S+ YKS+L + WP Sbjct: 171 KSYLNVLSYWPYKSYLNVLSYCPYKSYLNVLSYWPYKSYLNVLSYWP 217 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/47 (25%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +1 Query: 571 KSFSEIVQKFHFD*FENIVEHCNYGECI-LISFQVYKSWLELKFIWP 708 KS+ ++ + + + N++ +C Y + ++S+ YKS+L + WP Sbjct: 243 KSYLNVLSYWPYKSYLNVLSYCPYKSYLNVLSYWPYKSYLNVLSYWP 289 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/47 (25%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +1 Query: 571 KSFSEIVQKFHFD*FENIVEHCNYGECI-LISFQVYKSWLELKFIWP 708 KS+ ++ + + + N++ +C Y + ++S+ YKS+L + WP Sbjct: 291 KSYLNVLSYWPYKSYLNVLSYCPYKSYLNVLSYWPYKSYLNVLSYWP 337 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/47 (25%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +1 Query: 571 KSFSEIVQKFHFD*FENIVEHCNYGECI-LISFQVYKSWLELKFIWP 708 KS+ ++ + + + N++ +C Y + ++S+ YKS+L + WP Sbjct: 207 KSYLNVLSYWPYKSYLNVLSYCPYKSYLNVLSYCPYKSYLNVLSYWP 253 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/47 (25%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 571 KSFSEIVQKFHFD*FENIVEHCNYGECI-LISFQVYKSWLELKFIWP 708 KS+ + + + N++ +C Y + ++S+ +YKS+L + WP Sbjct: 135 KSYLNALSYCPYKSYLNVLSYCPYKSYLNVLSYWLYKSYLNVLSYWP 181 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,499,081 Number of Sequences: 59808 Number of extensions: 363366 Number of successful extensions: 625 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 619 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -