BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0589 (753 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 25 2.5 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 25 2.5 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 24 4.4 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 24 4.4 DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 24 5.8 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 25.0 bits (52), Expect = 2.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 245 KHTETCEKNPLPTKDVIEQEKS 310 K+T TCE LP +DV+ + S Sbjct: 477 KNTTTCEDYALPYQDVVPSDPS 498 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 337 TRKCISLVSPYFNIDVSQIDLRRPLQVLFLFLYN 438 TR C+ + +D S + R +Q L ++LYN Sbjct: 133 TRLCLPQIFNNILMDFSVEQINRSIQELMIYLYN 166 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 24.2 bits (50), Expect = 4.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 57 QTEAQSFHWCRRHGD 13 QT +Q+ HW + HGD Sbjct: 222 QTLSQANHWLKSHGD 236 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 24.2 bits (50), Expect = 4.4 Identities = 12/49 (24%), Positives = 28/49 (57%) Frame = +3 Query: 75 EKTQKSLFDGIEKFDSSQLKHTETQEKNPLPDKDAIEAEKEKNNS*TAS 221 E+T+KSL + +E ++ + +N ++A +A++ KN++ + S Sbjct: 148 ERTEKSLKEALEGCSQTETPVNGKRGRNLRSTEEADDAKRAKNDAPSGS 196 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = -1 Query: 114 TSRYRRIKTSGSSQWQRLQQTEAQSFHWCRRHGDSWCC 1 TS R+ GS Q ++ +WC G+ W C Sbjct: 379 TSAEGRLNADGSGDHGLFQISD---IYWCSPPGNGWAC 413 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 693,311 Number of Sequences: 2352 Number of extensions: 13159 Number of successful extensions: 23 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77755161 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -