BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0589 (753 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 1.3 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 5.4 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 21 9.4 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 24.2 bits (50), Expect = 1.3 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +2 Query: 425 CFCTMATLPGQWRRTATPDFIQILTISHAL 514 C C+M LPG +T+T ++ +I+ + + + Sbjct: 684 CNCSMDWLPGINNQTSTREYPRIMDLDNVM 713 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 5.4 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +3 Query: 114 FDSSQLKHTETQEKNPLPDKDAIEAEKEKNNS*T 215 FDS + +T +N P A+E ++ NS T Sbjct: 1139 FDSKVMTRPDTDSENWTPKMMAVEPTDKQANSKT 1172 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 577 PNFLCHFLNVYFISILRKY 633 P F+CH + F + KY Sbjct: 50 PTFMCHKYGLRFEEVSEKY 68 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,059 Number of Sequences: 438 Number of extensions: 4294 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -