BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0588 (790 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 23 2.4 AF134818-1|AAD40234.1| 130|Apis mellifera lambda crystallin-lik... 22 5.7 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 9.9 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 9.9 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 9.9 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 9.9 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 557 FALS*KSCCGKRCLSTIMALILASSIVFVL 468 F +S CCG S M + AS ++F+L Sbjct: 63 FVISFFGCCGAIRESHCMTITFASFLLFIL 92 >AF134818-1|AAD40234.1| 130|Apis mellifera lambda crystallin-like protein protein. Length = 130 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -3 Query: 224 WRLVALGIF*AKD 186 WRLVA GI AKD Sbjct: 22 WRLVADGILNAKD 34 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = +2 Query: 383 RSITRYGYKQSIRTSLEANSKKSQN 457 +++TR Y + +R + +KSQ+ Sbjct: 400 KALTRAAYSRDVRPKYDCTLEKSQD 424 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = +2 Query: 383 RSITRYGYKQSIRTSLEANSKKSQN 457 +++TR Y + +R + +KSQ+ Sbjct: 400 KALTRAAYSRDVRPKYDCTLEKSQD 424 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 9.9 Identities = 13/66 (19%), Positives = 28/66 (42%) Frame = +3 Query: 306 LDYVSNHRLDCFGGNS*RRVWEYETADQSRVTATSKAYERHSKRIPKNLRMAPSQHEHNR 485 +D+ N +D + N E T + ++ K+Y + + K++ + S + Sbjct: 421 IDHAKNTIID-YRNNDLSINEEKRTIENEQLNRMYKSYPNYIDKETKDMNLEISTRPKSN 479 Query: 486 TRQNQC 503 T +N C Sbjct: 480 TVENAC 485 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = +2 Query: 383 RSITRYGYKQSIRTSLEANSKKSQN 457 +++TR Y + +R + +KSQ+ Sbjct: 400 KALTRAAYSRDVRPKYDCTLEKSQD 424 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 221,639 Number of Sequences: 438 Number of extensions: 5117 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24882285 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -