BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0584 (707 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21435| Best HMM Match : DUF846 (HMM E-Value=4.3e-35) 100 1e-21 SB_9822| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 >SB_21435| Best HMM Match : DUF846 (HMM E-Value=4.3e-35) Length = 323 Score = 100 bits (240), Expect = 1e-21 Identities = 41/70 (58%), Positives = 56/70 (80%), Gaps = 2/70 (2%) Frame = +2 Query: 326 DDDTIAFGEEDNA--NKQFVHPYIVFFHLVFRCSAIIVYILCGWFSDSFIASFVLVILLL 499 +D + FG+E+ A ++F HPY+ FFHL FR S++I Y+LCGWFSDSFI +FV+++LLL Sbjct: 162 EDVALNFGDEEEALSRRKFRHPYVSFFHLFFRISSVIAYLLCGWFSDSFITNFVVIVLLL 221 Query: 500 SADFWTVKNI 529 S DFWTVKN+ Sbjct: 222 SCDFWTVKNV 231 Score = 55.6 bits (128), Expect = 4e-08 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = +3 Query: 531 SGRLLVGLRWWNYVDDNGKSPWVFEARQ 614 SGRLLVGLRWWNYVD++G S WVFE+++ Sbjct: 232 SGRLLVGLRWWNYVDEDGNSHWVFESKK 259 >SB_9822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +3 Query: 117 LRVIWIVCDLSNFQDYLLFLYNSICLTAVEIIDQYLSTYSDTHLKL 254 L+ + C S F D+LL + +C+T V +++Y S TH +L Sbjct: 78 LKASYAFCRASLFFDHLLKIATVLCMTGV-AVERYFSLARLTHRRL 122 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,711,808 Number of Sequences: 59808 Number of extensions: 455701 Number of successful extensions: 980 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 980 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -