Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-0583
         (802 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY008296-1|AAG22858.1|  556|Tribolium castaneum Dorsal protein.        23   2.8  
AJ457831-1|CAD29886.1|  249|Tribolium castaneum helix-loop-helix...    22   6.5  

>AY008296-1|AAG22858.1|  556|Tribolium castaneum Dorsal protein.
          Length = 556

 Score = 23.0 bits (47), Expect = 2.8
 Identities = 13/53 (24%), Positives = 28/53 (52%)
 Frame = +1

Query: 553 SAAIIPNMVKKIDLAPNVESDAAAVPEIKTPEAADAPKLADNPVDEDKPADIS 711
           S +++ +M+  ++  P+ ++D + V   +TP    +    DN   E KP D++
Sbjct: 445 STSVVGDMLN-MNWNPSAQNDLSGVNLSETPSGISSLLNLDNQQLELKPIDLN 496


>AJ457831-1|CAD29886.1|  249|Tribolium castaneum helix-loop-helix
           transcription factor protein.
          Length = 249

 Score = 21.8 bits (44), Expect = 6.5
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -3

Query: 77  MDPVTRRRFLKH 42
           +DPV +RR L+H
Sbjct: 127 LDPVVKRRLLQH 138


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.308    0.126    0.338 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 129,402
Number of Sequences: 336
Number of extensions: 2037
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 21791490
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.7 bits)