BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0578 (817 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 30 0.45 SPAC57A7.05 |||conserved protein |Schizosaccharomyces pombe|chr ... 29 1.0 SPBC1198.01 |||glutathione-dependent formaldehyde dehydrogenase ... 27 4.2 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 27 4.2 SPAC17A2.12 |||ATP-dependent DNA helicase|Schizosaccharomyces po... 26 7.4 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 29.9 bits (64), Expect = 0.45 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +1 Query: 70 TRQQSSQSQPHLPAVHPADQRTRLWQPSPSPSVLSYP 180 T QS P + P T + PSPSP+ SYP Sbjct: 301 TSMNMKQSSASHPVLQPPAPSTLQFNPSPSPAAPSYP 337 >SPAC57A7.05 |||conserved protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 1337 Score = 28.7 bits (61), Expect = 1.0 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Frame = +1 Query: 40 SGSPGLQEFGTRQQSSQSQPHLPAVHPADQRTRLWQPSP--SPSVLSYPNSTISYTSL 207 S +P + QSSQ HL P++++ L PSP PS S N Y L Sbjct: 129 SQNPSSSSSSSSSQSSQHSTHLQFQIPSNEKKSLDDPSPRRKPSFFSKSNLKRKYRYL 186 >SPBC1198.01 |||glutathione-dependent formaldehyde dehydrogenase |Schizosaccharomyces pombe|chr 2|||Manual Length = 423 Score = 26.6 bits (56), Expect = 4.2 Identities = 12/62 (19%), Positives = 27/62 (43%) Frame = +1 Query: 58 QEFGTRQQSSQSQPHLPAVHPADQRTRLWQPSPSPSVLSYPNSTISYTSLILLDVSEATV 237 ++ G R+ S S P A + +W + + P TI++ +++ + T+ Sbjct: 14 KQLGHREVSEGSTQPKPDPSGATMKACVWDGPLNVKIAEVPKPTITHPKDVIVKTTACTI 73 Query: 238 CA 243 C+ Sbjct: 74 CS 75 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 26.6 bits (56), Expect = 4.2 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +1 Query: 13 SPRWRPLXTSGSP-GLQEFGTRQQSSQSQPHLPAVHPADQRTRLWQPSPSP 162 SPR P+ SGSP + G + + P P+ H + ++ P+PSP Sbjct: 1589 SPRMGPVNNSGSPLAMNAAGQPSLAVPAVPSAPSNH-FNPFAKMQPPAPSP 1638 >SPAC17A2.12 |||ATP-dependent DNA helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 897 Score = 25.8 bits (54), Expect = 7.4 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +1 Query: 121 ADQRTRLWQPSPSPSVLSYPNSTISYTS 204 A Q +RL P P PS S P TIS S Sbjct: 173 AKQLSRLPTPLPPPSSSSLPTGTISTNS 200 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,243,085 Number of Sequences: 5004 Number of extensions: 66308 Number of successful extensions: 204 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 202 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 398435810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -