BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0578 (817 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g26350.1 68416.m03287 expressed protein ; expression support... 30 2.1 At1g17440.2 68414.m02133 transcription initiation factor IID (TF... 30 2.1 At1g17440.1 68414.m02132 transcription initiation factor IID (TF... 30 2.1 At3g10070.1 68416.m01207 transcription initiation factor IID (TF... 29 3.7 At4g32360.1 68417.m04607 NADP adrenodoxin-like ferredoxin reduct... 28 6.4 >At3g26350.1 68416.m03287 expressed protein ; expression supported by MPSS Length = 356 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +1 Query: 40 SGSPGLQEFG-TRQQSSQSQPHLPAV-HPADQRTRLWQPSP 156 S +P L+ G + Q+S +QPH+P + HP + QP P Sbjct: 18 SQNPHLKSGGASTSQTSSNQPHIPPIPHPKKSHHKTTQPHP 58 >At1g17440.2 68414.m02133 transcription initiation factor IID (TFIID) subunit A family protein similar to SP|Q16514 Transcription initiation factor TFIID 20/15 kDa subunits (TAFII-20/TAFII-15) {Homo sapiens}; contains Pfam profile PF03847: Transcription initiation factor TFIID subunit A Length = 683 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 85 SQSQPHLPAVHPADQRTRLWQPSPSPSVLSYPNSTI 192 + SQP++ + +P + PSPS LS+P+S++ Sbjct: 70 NNSQPNISSPNPTSSNPPIGAQIPSPSPLSHPSSSL 105 >At1g17440.1 68414.m02132 transcription initiation factor IID (TFIID) subunit A family protein similar to SP|Q16514 Transcription initiation factor TFIID 20/15 kDa subunits (TAFII-20/TAFII-15) {Homo sapiens}; contains Pfam profile PF03847: Transcription initiation factor TFIID subunit A Length = 683 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 85 SQSQPHLPAVHPADQRTRLWQPSPSPSVLSYPNSTI 192 + SQP++ + +P + PSPS LS+P+S++ Sbjct: 70 NNSQPNISSPNPTSSNPPIGAQIPSPSPLSHPSSSL 105 >At3g10070.1 68416.m01207 transcription initiation factor IID (TFIID) subunit A family protein similar to hypothetical protein GB:CAB10099 [Schizosaccharomyces pombe]; contains Pfam profile PF03847: Transcription initiation factor TFIID subunit A Length = 539 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 73 RQQSSQSQPHLPAVHPADQR-TRLWQPSPSPSVLSYPNSTIS 195 RQ S+ SQP P+D + + L Q P+PS P+S +S Sbjct: 5 RQSSTASQPPETPPQPSDSKPSTLTQIQPTPSTNPSPSSVVS 46 >At4g32360.1 68417.m04607 NADP adrenodoxin-like ferredoxin reductase identical to NADP adrenodoxin-like ferredoxin reductase GI:28192433 from [Arabidopsis thaliana] Length = 483 Score = 28.3 bits (60), Expect = 6.4 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +2 Query: 383 LRSGISPEHESENVNIKNFAHMKIHWSC*FM 475 +RSG++P+H + I F+ + H C F+ Sbjct: 62 VRSGVAPDHPETKIAINQFSRVAQHERCSFI 92 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,058,962 Number of Sequences: 28952 Number of extensions: 347622 Number of successful extensions: 784 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 760 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 782 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1863090400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -