BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0576 (589 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y11837-1|CAA72535.1| 729|Drosophila melanogaster bZIP transcrip... 37 0.023 BT030402-1|ABO52821.1| 610|Drosophila melanogaster FI01009p pro... 37 0.023 AY113444-1|AAM29449.1| 596|Drosophila melanogaster RE29005p pro... 37 0.023 AE014134-906|AAN10539.1| 610|Drosophila melanogaster CG14029-PC... 37 0.023 AE014134-905|AAF52237.1| 729|Drosophila melanogaster CG14029-PA... 37 0.023 >Y11837-1|CAA72535.1| 729|Drosophila melanogaster bZIP transcription factor protein. Length = 729 Score = 36.7 bits (81), Expect = 0.023 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = +2 Query: 458 PSNGSSGDSHDYGAFDFKRKDFFGQRKQREFIPDSKK 568 PS G +G A +K+ F QRKQREF PD+KK Sbjct: 205 PSQGGNGPQ---SALTAAQKELFSQRKQREFTPDNKK 238 >BT030402-1|ABO52821.1| 610|Drosophila melanogaster FI01009p protein. Length = 610 Score = 36.7 bits (81), Expect = 0.023 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = +2 Query: 458 PSNGSSGDSHDYGAFDFKRKDFFGQRKQREFIPDSKK 568 PS G +G A +K+ F QRKQREF PD+KK Sbjct: 86 PSQGGNGPQ---SALTAAQKELFSQRKQREFTPDNKK 119 >AY113444-1|AAM29449.1| 596|Drosophila melanogaster RE29005p protein. Length = 596 Score = 36.7 bits (81), Expect = 0.023 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = +2 Query: 458 PSNGSSGDSHDYGAFDFKRKDFFGQRKQREFIPDSKK 568 PS G +G A +K+ F QRKQREF PD+KK Sbjct: 86 PSQGGNGPQ---SALTAAQKELFSQRKQREFTPDNKK 119 >AE014134-906|AAN10539.1| 610|Drosophila melanogaster CG14029-PC, isoform C protein. Length = 610 Score = 36.7 bits (81), Expect = 0.023 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = +2 Query: 458 PSNGSSGDSHDYGAFDFKRKDFFGQRKQREFIPDSKK 568 PS G +G A +K+ F QRKQREF PD+KK Sbjct: 86 PSQGGNGPQ---SALTAAQKELFSQRKQREFTPDNKK 119 >AE014134-905|AAF52237.1| 729|Drosophila melanogaster CG14029-PA, isoform A protein. Length = 729 Score = 36.7 bits (81), Expect = 0.023 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = +2 Query: 458 PSNGSSGDSHDYGAFDFKRKDFFGQRKQREFIPDSKK 568 PS G +G A +K+ F QRKQREF PD+KK Sbjct: 205 PSQGGNGPQ---SALTAAQKELFSQRKQREFTPDNKK 238 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,897,286 Number of Sequences: 53049 Number of extensions: 462898 Number of successful extensions: 1415 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1415 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2358819486 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -