BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0576 (589 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 25 0.55 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 5.1 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 6.8 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 25.0 bits (52), Expect = 0.55 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 197 FDNSTAIWIIPAKEFSNTANIFNHSEDSCGPVTVRR 304 + + T +W+ K F+ IF HS D+ G + R Sbjct: 151 YSHQTDVWVELLKHFNYMKVIFIHSSDTDGRALLGR 186 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.8 bits (44), Expect = 5.1 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -2 Query: 294 VTGPHESSLWLKIFAVFENS 235 +T P E +W+ FA+ +S Sbjct: 388 ITIPKEMKIWIPAFAIHRDS 407 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 313 CRVHPEPATAA 345 CR+H PAT A Sbjct: 442 CRIHGSPATTA 452 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,963 Number of Sequences: 438 Number of extensions: 2653 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17115420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -