BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0574 (614 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 23 3.1 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 23 3.1 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 23 3.1 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 23 3.1 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 21 9.6 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 21 9.6 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 21 9.6 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 21 9.6 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = -1 Query: 401 CFNKNRTHERHAQKETKAQRGIVFIVLALALGRGLP 294 C+N++RT ERH + + ++ ++ + LP Sbjct: 329 CWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALP 364 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 22.6 bits (46), Expect = 3.1 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +2 Query: 491 LGQFCVIYFFLLTTSLLV 544 +G+ +I FF+LTT L++ Sbjct: 1 MGRITIIRFFVLTTMLMM 18 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = -1 Query: 401 CFNKNRTHERHAQKETKAQRGIVFIVLALALGRGLP 294 C+N++RT ERH + + ++ ++ + LP Sbjct: 329 CWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALP 364 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = -1 Query: 401 CFNKNRTHERHAQKETKAQRGIVFIVLALALGRGLP 294 C+N++RT ERH + + ++ ++ + LP Sbjct: 329 CWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALP 364 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.0 bits (42), Expect = 9.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 274 TAVLPNPGNPRPRASAKTIKTIPRCAF 354 TA L P P AKTI I R F Sbjct: 444 TAELRKKEPPHPIRVAKTIDVIARITF 470 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.0 bits (42), Expect = 9.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 274 TAVLPNPGNPRPRASAKTIKTIPRCAF 354 TA L P P AKTI I R F Sbjct: 430 TAELRKKEPPHPIRVAKTIDVIARITF 456 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.0 bits (42), Expect = 9.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 274 TAVLPNPGNPRPRASAKTIKTIPRCAF 354 TA L P P AKTI I R F Sbjct: 464 TAELRKKEPPHPIRVAKTIDVIARITF 490 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.0 bits (42), Expect = 9.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 274 TAVLPNPGNPRPRASAKTIKTIPRCAF 354 TA L P P AKTI I R F Sbjct: 413 TAELRKKEPPHPIRVAKTIDVIARITF 439 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,995 Number of Sequences: 438 Number of extensions: 3520 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -