BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0574 (614 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g47790.1 68416.m05206 ABC transporter family protein contains... 28 4.3 At3g18680.2 68416.m02373 aspartate/glutamate/uridylate kinase fa... 28 4.3 At3g18680.1 68416.m02372 aspartate/glutamate/uridylate kinase fa... 28 4.3 At3g20260.1 68416.m02566 expressed protein 28 5.7 At2g42040.1 68415.m05199 expressed protein 28 5.7 At3g27870.1 68416.m03475 haloacid dehalogenase-like hydrolase fa... 27 7.5 >At3g47790.1 68416.m05206 ABC transporter family protein contains Pfam domain, PF00005: ABC transporter Length = 901 Score = 28.3 bits (60), Expect = 4.3 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -2 Query: 316 WLSVGGCQDSVTRPFLMARRPRPLHLSAEAYLFQLRQS 203 W + D+V RP + R PR ++L++ AYL L+ S Sbjct: 255 WYNSTYKNDTVVRPMALIRVPRLVNLASNAYLEFLKGS 292 >At3g18680.2 68416.m02373 aspartate/glutamate/uridylate kinase family protein similar to UMP-kinase GB:CAB38122 gi:4468612 from [Lactococcus lactis] ; contains Pfam profile PF00696: Amino acid kinase family Length = 366 Score = 28.3 bits (60), Expect = 4.3 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = -3 Query: 144 ALKLSKI*NPYYRRKRALLHLQRGR 70 A ++S++ PY RR RA+ HL++GR Sbjct: 195 AFRMSEVAEPYIRR-RAIRHLEKGR 218 >At3g18680.1 68416.m02372 aspartate/glutamate/uridylate kinase family protein similar to UMP-kinase GB:CAB38122 gi:4468612 from [Lactococcus lactis] ; contains Pfam profile PF00696: Amino acid kinase family Length = 339 Score = 28.3 bits (60), Expect = 4.3 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = -3 Query: 144 ALKLSKI*NPYYRRKRALLHLQRGR 70 A ++S++ PY RR RA+ HL++GR Sbjct: 195 AFRMSEVAEPYIRR-RAIRHLEKGR 218 >At3g20260.1 68416.m02566 expressed protein Length = 437 Score = 27.9 bits (59), Expect = 5.7 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +1 Query: 226 MLLLRDEAVEDASPSGTAVLPNPGNPRPRASAKTIKTIPRC 348 ML + + +G + P+P P PR+++K + + RC Sbjct: 131 MLFFDRLSSQQLKETGIGIAPSPSTPSPRSASKKLSSPFRC 171 >At2g42040.1 68415.m05199 expressed protein Length = 269 Score = 27.9 bits (59), Expect = 5.7 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +1 Query: 241 DEAVEDASPSGTAVLPNPGNPRPRASAKTIKTIPRCAFVSFCAWRSCVRFLL 396 DE E+AS G + N G + + S ++ RC+ V+ WR C + L+ Sbjct: 136 DEEDEEASGGGGRI--NKGKKKAKKSGGGLEEGSRCSRVNGRGWRCCQQTLV 185 >At3g27870.1 68416.m03475 haloacid dehalogenase-like hydrolase family protein similar to Potential phospholipid-transporting ATPase (EC 3.6.3.1) from {Mus musculus} SP|P98200, Homo sapiens SP|O43520, {Arabidopsis thaliana} SP|P98204; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 1174 Score = 27.5 bits (58), Expect = 7.5 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 190 LVDASSDVAGRDMLLLRDEAVEDASPSG 273 L+DA++D +D++LL AVED G Sbjct: 673 LIDAAADKIEKDLILLGSTAVEDKLQKG 700 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,327,528 Number of Sequences: 28952 Number of extensions: 240827 Number of successful extensions: 610 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 602 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 610 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1236350304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -